Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57620
Gene name	Stromal interaction molecule 2
Gene symbol	STIM2
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4p15.2
Summary	This gene is a member of the stromal interaction molecule (STIM) family and likely arose, along with related family member STIM1, from a common ancestral gene. The encoded protein functions to regulate calcium concentrations in the cytosol and endoplasmic

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036939	hsa-miR-877-3p	CLASH	23622248
MIRT439526	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT439524	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT439526	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT439524	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT1397053	hsa-miR-181a	CLIP-seq
MIRT1397054	hsa-miR-181b	CLIP-seq
MIRT1397055	hsa-miR-181c	CLIP-seq
MIRT1397056	hsa-miR-181d	CLIP-seq
MIRT1397057	hsa-miR-4262	CLIP-seq
MIRT1397058	hsa-miR-4323	CLIP-seq
MIRT1397059	hsa-miR-4653-3p	CLIP-seq
MIRT1397060	hsa-miR-125a-5p	CLIP-seq
MIRT1397061	hsa-miR-125b	CLIP-seq
MIRT1397062	hsa-miR-1297	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397071	hsa-miR-26a	CLIP-seq
MIRT1397072	hsa-miR-26b	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397075	hsa-miR-3065-3p	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397078	hsa-miR-3136-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397082	hsa-miR-3663-3p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397084	hsa-miR-3682-5p	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT1397087	hsa-miR-4319	CLIP-seq
MIRT1397088	hsa-miR-4439	CLIP-seq
MIRT1397089	hsa-miR-4465	CLIP-seq
MIRT1397090	hsa-miR-4513	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397093	hsa-miR-4690-3p	CLIP-seq
MIRT1397094	hsa-miR-4732-3p	CLIP-seq
MIRT1397095	hsa-miR-4753-3p	CLIP-seq
MIRT1397096	hsa-miR-518a-3p	CLIP-seq
MIRT1397097	hsa-miR-518b	CLIP-seq
MIRT1397098	hsa-miR-518c	CLIP-seq
MIRT1397099	hsa-miR-518d-3p	CLIP-seq
MIRT1397100	hsa-miR-518f	CLIP-seq
MIRT1397101	hsa-miR-548c-3p	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397106	hsa-miR-670	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT1397108	hsa-miR-1284	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397109	hsa-miR-2467-3p	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397110	hsa-miR-3614-5p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397111	hsa-miR-3678-3p	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397112	hsa-miR-4738-3p	CLIP-seq
MIRT1397113	hsa-miR-4756-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397115	hsa-miR-582-5p	CLIP-seq
MIRT1397116	hsa-miR-618	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT1557148	hsa-miR-153	CLIP-seq
MIRT1557149	hsa-miR-448	CLIP-seq
MIRT2118876	hsa-miR-129-5p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT2118877	hsa-miR-4255	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT1397063	hsa-miR-1299	CLIP-seq
MIRT2341239	hsa-miR-1305	CLIP-seq
MIRT1397064	hsa-miR-130a	CLIP-seq
MIRT1397065	hsa-miR-130b	CLIP-seq
MIRT1397066	hsa-miR-145	CLIP-seq
MIRT2341240	hsa-miR-146a	CLIP-seq
MIRT2341241	hsa-miR-146b-5p	CLIP-seq
MIRT1557148	hsa-miR-153	CLIP-seq
MIRT1397067	hsa-miR-199a-3p	CLIP-seq
MIRT1397068	hsa-miR-199b-3p	CLIP-seq
MIRT1397109	hsa-miR-2467-3p	CLIP-seq
MIRT1397073	hsa-miR-301a	CLIP-seq
MIRT1397074	hsa-miR-301b	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397077	hsa-miR-3129-5p	CLIP-seq
MIRT1397079	hsa-miR-3148	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT2341242	hsa-miR-330-3p	CLIP-seq
MIRT1397110	hsa-miR-3614-5p	CLIP-seq
MIRT1397083	hsa-miR-3666	CLIP-seq
MIRT1397111	hsa-miR-3678-3p	CLIP-seq
MIRT2341243	hsa-miR-4251	CLIP-seq
MIRT1397085	hsa-miR-4275	CLIP-seq
MIRT1397086	hsa-miR-4295	CLIP-seq
MIRT2341244	hsa-miR-4420	CLIP-seq
MIRT2341245	hsa-miR-4436b-5p	CLIP-seq
MIRT1557149	hsa-miR-448	CLIP-seq
MIRT1397091	hsa-miR-454	CLIP-seq
MIRT2341246	hsa-miR-466	CLIP-seq
MIRT1397092	hsa-miR-4671-3p	CLIP-seq
MIRT1397113	hsa-miR-4756-3p	CLIP-seq
MIRT2341247	hsa-miR-499-3p	CLIP-seq
MIRT2341248	hsa-miR-499a-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq
MIRT1397115	hsa-miR-582-5p	CLIP-seq
MIRT2341249	hsa-miR-589	CLIP-seq
MIRT1397105	hsa-miR-622	CLIP-seq
MIRT1397107	hsa-miR-875-3p	CLIP-seq
MIRT2118876	hsa-miR-129-5p	CLIP-seq
MIRT2635136	hsa-miR-188-3p	CLIP-seq
MIRT1397069	hsa-miR-2113	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397075	hsa-miR-3065-3p	CLIP-seq
MIRT1397076	hsa-miR-3065-5p	CLIP-seq
MIRT1397080	hsa-miR-3152-3p	CLIP-seq
MIRT2635137	hsa-miR-3925-3p	CLIP-seq
MIRT2635138	hsa-miR-3941	CLIP-seq
MIRT2118877	hsa-miR-4255	CLIP-seq
MIRT2341246	hsa-miR-466	CLIP-seq
MIRT2635139	hsa-miR-4672	CLIP-seq
MIRT1397101	hsa-miR-548c-3p	CLIP-seq
MIRT1397102	hsa-miR-570	CLIP-seq
MIRT1397104	hsa-miR-599	CLIP-seq
MIRT2635140	hsa-miR-766	CLIP-seq
MIRT1397070	hsa-miR-2277-5p	CLIP-seq
MIRT1397081	hsa-miR-3180-5p	CLIP-seq
MIRT1397112	hsa-miR-4738-3p	CLIP-seq
MIRT1397114	hsa-miR-513b	CLIP-seq
MIRT1397096	hsa-miR-518a-3p	CLIP-seq
MIRT1397097	hsa-miR-518b	CLIP-seq
MIRT1397098	hsa-miR-518c	CLIP-seq
MIRT1397099	hsa-miR-518d-3p	CLIP-seq
MIRT1397100	hsa-miR-518f	CLIP-seq
MIRT1397103	hsa-miR-579	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002115	Process	Store-operated calcium entry	IBA
GO:0005246	Function	Calcium channel regulator activity	IBA
GO:0005246	Function	Calcium channel regulator activity	IEA
GO:0005246	Function	Calcium channel regulator activity	IMP	18160041
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	18166150
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	11463338, 17905723, 28514442, 33961781, 35271311
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	18160041
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18160041
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IBA
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	IMP	18160041
GO:0015279	Function	Store-operated calcium channel activity	IDA	16860747
GO:0016020	Component	Membrane	IEA
GO:0032237	Process	Activation of store-operated calcium channel activity	IDA	17905723
GO:0032237	Process	Activation of store-operated calcium channel activity	IMP	18160041
GO:0046872	Function	Metal ion binding	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	17905723
GO:0051928	Process	Positive regulation of calcium ion transport	IMP	18160041
GO:0070588	Process	Calcium ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
610841	19205	ENSG00000109689

Q9P246

Protein name

Stromal interaction molecule 2

Protein function

Plays a role in mediating store-operated Ca(2+) entry (SOCE), a Ca(2+) influx following depletion of intracellular Ca(2+) stores. Functions as a highly sensitive Ca(2+) sensor in the endoplasmic reticulum which activates both store-operated and

PDB

2L5Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07647	SAM_2	133 → 202	SAM domain (Sterile alpha motif)	Domain
PF16533	SOAR	345 → 445	STIM1 Orai1-activating region	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues and tumor cell lines examined. {ECO:0000269|PubMed:11463338}.

Sequence

MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK

Sequence length

746

Interactions

View interactions

	KEGG
	Calcium signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRONCHIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TIETZE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22129055, 28087881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21224390, 31464639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20395295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25143380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25143380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27544849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30910863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30543678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30543678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30475382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32315120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17002787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29623030, 30455632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29351410	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29358461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30910863		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30208327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	30910863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21224390, 31464639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28087881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22125164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31464639		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24472175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27544849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32315120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31271217, 31287239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17002787, 21224390, 22125164, 24472175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30455632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31075835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35669690	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30208327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	24603752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29358461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	29358461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STIM2 (stromal interaction molecule 2)