Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57602
Gene name	Ubiquitin specific peptidase 36
Gene symbol	USP36
Synonyms (NCBI Gene)	DUB1
Chromosome	17
Chromosome location	17q25.3
Summary	This gene encodes a member of the peptidase C19 or ubiquitin-specific protease family of cysteine proteases. Members of this family remove ubiquitin molecules from polyubiquitinated proteins. The encoded protein may deubiquitinate and stabilize the transc

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027793	hsa-miR-98-5p	Microarray	19088304
MIRT043617	hsa-miR-151a-3p	CLASH	23622248
MIRT040098	hsa-miR-615-3p	CLASH	23622248
MIRT038207	hsa-miR-342-5p	CLASH	23622248
MIRT451787	hsa-miR-3154	PAR-CLIP	23592263
MIRT451785	hsa-miR-4499	PAR-CLIP	23592263
MIRT451786	hsa-miR-9500	PAR-CLIP	23592263
MIRT451784	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT451783	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT451782	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT451781	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT451780	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451779	hsa-miR-6080	PAR-CLIP	23592263
MIRT451778	hsa-miR-7515	PAR-CLIP	23592263
MIRT451777	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT451776	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT451775	hsa-miR-6124	PAR-CLIP	23592263
MIRT451774	hsa-miR-6077	PAR-CLIP	23592263
MIRT451773	hsa-miR-4434	PAR-CLIP	23592263
MIRT451772	hsa-miR-4516	PAR-CLIP	23592263
MIRT451771	hsa-miR-5703	PAR-CLIP	23592263
MIRT451770	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT451769	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT451768	hsa-miR-4531	PAR-CLIP	23592263
MIRT451787	hsa-miR-3154	PAR-CLIP	23592263
MIRT451785	hsa-miR-4499	PAR-CLIP	23592263
MIRT451786	hsa-miR-9500	PAR-CLIP	23592263
MIRT451784	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT451783	hsa-miR-3681-5p	PAR-CLIP	23592263
MIRT451782	hsa-miR-6849-5p	PAR-CLIP	23592263
MIRT451781	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT451780	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT451779	hsa-miR-6080	PAR-CLIP	23592263
MIRT451778	hsa-miR-7515	PAR-CLIP	23592263
MIRT451777	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT451776	hsa-miR-873-3p	PAR-CLIP	23592263
MIRT451775	hsa-miR-6124	PAR-CLIP	23592263
MIRT451774	hsa-miR-6077	PAR-CLIP	23592263
MIRT451773	hsa-miR-4434	PAR-CLIP	23592263
MIRT451772	hsa-miR-4516	PAR-CLIP	23592263
MIRT451771	hsa-miR-5703	PAR-CLIP	23592263
MIRT451770	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT451769	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT451768	hsa-miR-4531	PAR-CLIP	23592263
MIRT1479289	hsa-miR-1207-5p	CLIP-seq
MIRT1479290	hsa-miR-1237	CLIP-seq
MIRT1479291	hsa-miR-1279	CLIP-seq
MIRT1479292	hsa-miR-1302	CLIP-seq
MIRT1479293	hsa-miR-134	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479295	hsa-miR-153	CLIP-seq
MIRT1479296	hsa-miR-188-3p	CLIP-seq
MIRT1479297	hsa-miR-2052	CLIP-seq
MIRT1479298	hsa-miR-224	CLIP-seq
MIRT1479299	hsa-miR-2276	CLIP-seq
MIRT1479300	hsa-miR-298	CLIP-seq
MIRT1479301	hsa-miR-300	CLIP-seq
MIRT1479302	hsa-miR-31	CLIP-seq
MIRT1479303	hsa-miR-3118	CLIP-seq
MIRT1479304	hsa-miR-3120-3p	CLIP-seq
MIRT1479305	hsa-miR-3122	CLIP-seq
MIRT1479306	hsa-miR-3128	CLIP-seq
MIRT1479307	hsa-miR-3149	CLIP-seq
MIRT1479308	hsa-miR-3153	CLIP-seq
MIRT1479309	hsa-miR-3158-5p	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT1479311	hsa-miR-329	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT1479313	hsa-miR-3620	CLIP-seq
MIRT1479314	hsa-miR-362-3p	CLIP-seq
MIRT1479315	hsa-miR-3667-3p	CLIP-seq
MIRT1479316	hsa-miR-3692	CLIP-seq
MIRT1479317	hsa-miR-376c	CLIP-seq
MIRT1479318	hsa-miR-381	CLIP-seq
MIRT1479319	hsa-miR-3913-5p	CLIP-seq
MIRT1479320	hsa-miR-3925-3p	CLIP-seq
MIRT1479321	hsa-miR-3941	CLIP-seq
MIRT1479322	hsa-miR-4261	CLIP-seq
MIRT1479323	hsa-miR-4269	CLIP-seq
MIRT1479324	hsa-miR-4298	CLIP-seq
MIRT1479325	hsa-miR-4307	CLIP-seq
MIRT1479326	hsa-miR-4330	CLIP-seq
MIRT1479327	hsa-miR-4424	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT1479329	hsa-miR-4459	CLIP-seq
MIRT1479330	hsa-miR-4477a	CLIP-seq
MIRT1479331	hsa-miR-448	CLIP-seq
MIRT1479332	hsa-miR-4496	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT1479334	hsa-miR-4639-5p	CLIP-seq
MIRT1479335	hsa-miR-4642	CLIP-seq
MIRT1479336	hsa-miR-4643	CLIP-seq
MIRT1479337	hsa-miR-4666-3p	CLIP-seq
MIRT1479338	hsa-miR-4668-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT1479340	hsa-miR-4695-5p	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT1479342	hsa-miR-4715-5p	CLIP-seq
MIRT1479343	hsa-miR-4729	CLIP-seq
MIRT1479344	hsa-miR-4736	CLIP-seq
MIRT1479345	hsa-miR-4742-3p	CLIP-seq
MIRT1479346	hsa-miR-4763-3p	CLIP-seq
MIRT1479347	hsa-miR-4772-3p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT1479350	hsa-miR-485-5p	CLIP-seq
MIRT1479351	hsa-miR-486-5p	CLIP-seq
MIRT1479352	hsa-miR-494	CLIP-seq
MIRT1479353	hsa-miR-526b	CLIP-seq
MIRT1479354	hsa-miR-544	CLIP-seq
MIRT1479355	hsa-miR-548v	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT1479357	hsa-miR-603	CLIP-seq
MIRT1479358	hsa-miR-642b	CLIP-seq
MIRT1479359	hsa-miR-665	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT1479361	hsa-miR-766	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479301	hsa-miR-300	CLIP-seq
MIRT2144320	hsa-miR-3155	CLIP-seq
MIRT2144321	hsa-miR-3155b	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT1479317	hsa-miR-376c	CLIP-seq
MIRT1479318	hsa-miR-381	CLIP-seq
MIRT1479323	hsa-miR-4269	CLIP-seq
MIRT1479327	hsa-miR-4424	CLIP-seq
MIRT2144322	hsa-miR-4438	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT1479337	hsa-miR-4666-3p	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT1479343	hsa-miR-4729	CLIP-seq
MIRT2144324	hsa-miR-4738-5p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT2144325	hsa-miR-484	CLIP-seq
MIRT1479353	hsa-miR-526b	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT2144326	hsa-miR-922	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364485	hsa-miR-124	CLIP-seq
MIRT2364486	hsa-miR-1253	CLIP-seq
MIRT2364487	hsa-miR-1254	CLIP-seq
MIRT2364488	hsa-miR-1301	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479296	hsa-miR-188-3p	CLIP-seq
MIRT1479299	hsa-miR-2276	CLIP-seq
MIRT2364489	hsa-miR-25	CLIP-seq
MIRT2364490	hsa-miR-2964a-5p	CLIP-seq
MIRT2364491	hsa-miR-3116	CLIP-seq
MIRT1479304	hsa-miR-3120-3p	CLIP-seq
MIRT1479306	hsa-miR-3128	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364493	hsa-miR-32	CLIP-seq
MIRT1479311	hsa-miR-329	CLIP-seq
MIRT1479314	hsa-miR-362-3p	CLIP-seq
MIRT2364494	hsa-miR-363	CLIP-seq
MIRT2364495	hsa-miR-367	CLIP-seq
MIRT1479321	hsa-miR-3941	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2364497	hsa-miR-3978	CLIP-seq
MIRT1479326	hsa-miR-4330	CLIP-seq
MIRT2364498	hsa-miR-4470	CLIP-seq
MIRT2364499	hsa-miR-4660	CLIP-seq
MIRT2364500	hsa-miR-4690-3p	CLIP-seq
MIRT2364501	hsa-miR-4708-3p	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364503	hsa-miR-4740-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT1479349	hsa-miR-4789-5p	CLIP-seq
MIRT2364505	hsa-miR-5047	CLIP-seq
MIRT2364506	hsa-miR-506	CLIP-seq
MIRT1479355	hsa-miR-548v	CLIP-seq
MIRT1479357	hsa-miR-603	CLIP-seq
MIRT2364507	hsa-miR-875-3p	CLIP-seq
MIRT2364508	hsa-miR-92a	CLIP-seq
MIRT2364509	hsa-miR-92b	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT1479325	hsa-miR-4307	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2658355	hsa-miR-1224-5p	CLIP-seq
MIRT2658356	hsa-miR-1236	CLIP-seq
MIRT2658357	hsa-miR-1245b-3p	CLIP-seq
MIRT1479291	hsa-miR-1279	CLIP-seq
MIRT2658358	hsa-miR-1293	CLIP-seq
MIRT2658359	hsa-miR-1296	CLIP-seq
MIRT1479294	hsa-miR-137	CLIP-seq
MIRT1479295	hsa-miR-153	CLIP-seq
MIRT1479305	hsa-miR-3122	CLIP-seq
MIRT1479308	hsa-miR-3153	CLIP-seq
MIRT1479310	hsa-miR-3169	CLIP-seq
MIRT2658360	hsa-miR-3179	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2658361	hsa-miR-3202	CLIP-seq
MIRT1479312	hsa-miR-3613-3p	CLIP-seq
MIRT2658362	hsa-miR-3652	CLIP-seq
MIRT1479319	hsa-miR-3913-5p	CLIP-seq
MIRT2658363	hsa-miR-3936	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT1479322	hsa-miR-4261	CLIP-seq
MIRT2658364	hsa-miR-4303	CLIP-seq
MIRT2658365	hsa-miR-4430	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT2658366	hsa-miR-4457	CLIP-seq
MIRT2658367	hsa-miR-4476	CLIP-seq
MIRT1479331	hsa-miR-448	CLIP-seq
MIRT2658368	hsa-miR-4483	CLIP-seq
MIRT1479332	hsa-miR-4496	CLIP-seq
MIRT2658369	hsa-miR-4505	CLIP-seq
MIRT2658370	hsa-miR-4512	CLIP-seq
MIRT1479333	hsa-miR-4515	CLIP-seq
MIRT1479334	hsa-miR-4639-5p	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT2658371	hsa-miR-4664-5p	CLIP-seq
MIRT1479338	hsa-miR-4668-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT1479341	hsa-miR-4700-3p	CLIP-seq
MIRT2658372	hsa-miR-4719	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2658373	hsa-miR-4751	CLIP-seq
MIRT2658374	hsa-miR-4753-5p	CLIP-seq
MIRT2658375	hsa-miR-4762-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT1479348	hsa-miR-4786-3p	CLIP-seq
MIRT2658376	hsa-miR-486-3p	CLIP-seq
MIRT1479352	hsa-miR-494	CLIP-seq
MIRT2658377	hsa-miR-513b	CLIP-seq
MIRT2658378	hsa-miR-516a-5p	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT2658379	hsa-miR-615-5p	CLIP-seq
MIRT1479360	hsa-miR-671-5p	CLIP-seq
MIRT2364484	hsa-miR-1202	CLIP-seq
MIRT2658355	hsa-miR-1224-5p	CLIP-seq
MIRT2658356	hsa-miR-1236	CLIP-seq
MIRT2658358	hsa-miR-1293	CLIP-seq
MIRT2658359	hsa-miR-1296	CLIP-seq
MIRT2658360	hsa-miR-3179	CLIP-seq
MIRT2364492	hsa-miR-3194-5p	CLIP-seq
MIRT2658361	hsa-miR-3202	CLIP-seq
MIRT2658362	hsa-miR-3652	CLIP-seq
MIRT2658363	hsa-miR-3936	CLIP-seq
MIRT2364496	hsa-miR-3972	CLIP-seq
MIRT2658364	hsa-miR-4303	CLIP-seq
MIRT2658365	hsa-miR-4430	CLIP-seq
MIRT1479328	hsa-miR-4444	CLIP-seq
MIRT2658366	hsa-miR-4457	CLIP-seq
MIRT2658367	hsa-miR-4476	CLIP-seq
MIRT2658368	hsa-miR-4483	CLIP-seq
MIRT2658369	hsa-miR-4505	CLIP-seq
MIRT2658370	hsa-miR-4512	CLIP-seq
MIRT2144323	hsa-miR-4649-3p	CLIP-seq
MIRT2658371	hsa-miR-4664-5p	CLIP-seq
MIRT1479339	hsa-miR-4688	CLIP-seq
MIRT2364502	hsa-miR-4727-5p	CLIP-seq
MIRT2658373	hsa-miR-4751	CLIP-seq
MIRT2658374	hsa-miR-4753-5p	CLIP-seq
MIRT2658375	hsa-miR-4762-3p	CLIP-seq
MIRT2364504	hsa-miR-4769-3p	CLIP-seq
MIRT2658376	hsa-miR-486-3p	CLIP-seq
MIRT2658377	hsa-miR-513b	CLIP-seq
MIRT2658378	hsa-miR-516a-5p	CLIP-seq
MIRT1479356	hsa-miR-587	CLIP-seq
MIRT2658379	hsa-miR-615-5p	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	19615732, 25775507, 27445338, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	19208757, 25775507
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	27445338
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006325	Process	Chromatin organization	IMP	29274341
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007000	Process	Nucleolus organization	IEA
GO:0007000	Process	Nucleolus organization	ISS
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016242	Process	Negative regulation of macroautophagy	IMP	22622177
GO:0016579	Process	Protein deubiquitination	IDA	19208757, 25775507
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	IMP	27445338
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0031647	Process	Regulation of protein stability	IMP	27445338
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0140936	Function	Histone H2B deubiquitinase activity	IMP	29274341
GO:1901524	Process	Regulation of mitophagy	HMP	24912190
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24912190
GO:1990380	Function	K48-linked deubiquitinase activity	IDA	35989368
GO:2000232	Process	Regulation of rRNA processing	IDA	19208757
GO:2000232	Process	Regulation of rRNA processing	IEA
GO:2000232	Process	Regulation of rRNA processing	ISS

MIM	HGNC	e!Ensembl
612543	20062	ENSG00000055483

Q9P275

Protein name

Ubiquitin carboxyl-terminal hydrolase 36 (EC 2.3.2.-) (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36)

Protein function

Deubiquitinase essential for the regulation of nucleolar structure and function (PubMed:19208757, PubMed:22902402, PubMed:29273634). Required for cell and organism viability (PubMed:19208757, PubMed:22902402, PubMed:29273634). Plays an important

PDB

8BS3 , 8BS9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	122 → 420	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed. {ECO:0000269|PubMed:14715245}.

Sequence

MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKY
VLLNPKTEGASRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
GAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNNG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPH
TTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPA
PPQHFSPRTAQGLPGTSNSNSSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGND
ESAGLDRRGSSSSSPEHSASSDSTKAPQTPRSGAAHLCDSQETNCSTAGHSKTPPSGADS
KTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLWRATGNDLRPPPPSPSSDLTH
PMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSI
STALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAP
HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQ
VGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPLRHSCSPMGDGDPEAMEESPRKKKKKK
RKQETQRAVEEDGHLKCPRSAKPQDAVVPESSSCAPSANGWCPGDRMGLSQAPPVSWNGE
RESDVVQELLKYSSDKAYGRKVLTWDGKMSAVSQDAIEDSRQARTETVVDDWDEEFDRGK
EKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYRR

Sequence length

1123

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	25775507, 36305548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36239338, 36950067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35748266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39950338	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22865700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22865700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36470870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36239338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30975468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30975468		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18566677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18566677	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28621160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34526665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP36 (ubiquitin specific peptidase 36)