Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57596
Gene name	Brain enriched guanylate kinase associated
Gene symbol	BEGAIN
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q32.2

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments
MIRT820659	hsa-let-7a	CLIP-seq
MIRT820660	hsa-let-7b	CLIP-seq
MIRT820661	hsa-let-7c	CLIP-seq
MIRT820662	hsa-let-7d	CLIP-seq
MIRT820663	hsa-let-7e	CLIP-seq
MIRT820664	hsa-let-7f	CLIP-seq
MIRT820665	hsa-let-7g	CLIP-seq
MIRT820666	hsa-let-7i	CLIP-seq
MIRT820667	hsa-miR-1266	CLIP-seq
MIRT820668	hsa-miR-202	CLIP-seq
MIRT820669	hsa-miR-208a	CLIP-seq
MIRT820670	hsa-miR-208b	CLIP-seq
MIRT820671	hsa-miR-24	CLIP-seq
MIRT820672	hsa-miR-3127-5p	CLIP-seq
MIRT820673	hsa-miR-3141	CLIP-seq
MIRT820674	hsa-miR-3689a-3p	CLIP-seq
MIRT820675	hsa-miR-3689c	CLIP-seq
MIRT820676	hsa-miR-3918	CLIP-seq
MIRT820677	hsa-miR-3927	CLIP-seq
MIRT820678	hsa-miR-4437	CLIP-seq
MIRT820679	hsa-miR-4451	CLIP-seq
MIRT820680	hsa-miR-4458	CLIP-seq
MIRT820681	hsa-miR-4500	CLIP-seq
MIRT820682	hsa-miR-4518	CLIP-seq
MIRT820683	hsa-miR-4649-3p	CLIP-seq
MIRT820684	hsa-miR-4721	CLIP-seq
MIRT820685	hsa-miR-4728-5p	CLIP-seq
MIRT820686	hsa-miR-654-3p	CLIP-seq
MIRT820687	hsa-miR-98	CLIP-seq
MIRT1942538	hsa-miR-1587	CLIP-seq
MIRT1942539	hsa-miR-1908	CLIP-seq
MIRT1942540	hsa-miR-4417	CLIP-seq
MIRT1942541	hsa-miR-4492	CLIP-seq
MIRT1942542	hsa-miR-4498	CLIP-seq
MIRT1942543	hsa-miR-4656	CLIP-seq
MIRT1942544	hsa-miR-4675	CLIP-seq
MIRT1942545	hsa-miR-4706	CLIP-seq
MIRT1942546	hsa-miR-4741	CLIP-seq
MIRT1942547	hsa-miR-4749-5p	CLIP-seq
MIRT1942548	hsa-miR-663	CLIP-seq
MIRT1942549	hsa-miR-762	CLIP-seq
MIRT1942550	hsa-miR-939	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IBA
GO:0098794	Component	Postsynapse	IEA
GO:0098817	Process	Evoked excitatory postsynaptic potential	IBA

MIM	HGNC	e!Ensembl
618597	24163	ENSG00000183092

Q9BUH8

Protein name

Brain-enriched guanylate kinase-associated protein

Protein function

May sustain the structure of the postsynaptic density (PSD).

Family and domains

Sequence

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRI
QSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELY
RKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPT
CVIAKVLEKPDPASLSSRLSDASARDLAFCDGVEKPGPRPPYKGDIYCSDTALYCPEERR
RDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSY
SSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPL
EAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGD
DLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQG
SRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

Sequence length

593

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, PAPILLARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	26962152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	38019471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	26962152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26962152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Nonmedullary Thyroid Cancer	Thyroid cancer	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	CTD_human_DG	28030816		★★★★★ ★☆☆☆☆ Found in Text Mining only

BEGAIN (brain enriched guanylate kinase associated)