KIF17 (kinesin family member 17)

Gene

• Entrez ID: 57576
• Gene name: Kinesin family member 17
• Gene symbol: KIF17
• Synonyms (NCBI Gene): KIF17B, KIF3X, KLP-2, OSM-3
• Chromosome: 1
• Chromosome location: 1p36.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016958	hsa-miR-335-5p	Microarray	18185580
MIRT1093454	hsa-miR-148a	CLIP-seq
MIRT1093455	hsa-miR-148b	CLIP-seq
MIRT1093456	hsa-miR-152	CLIP-seq
MIRT1093457	hsa-miR-34a	CLIP-seq
MIRT1093458	hsa-miR-34c-5p	CLIP-seq
MIRT1093459	hsa-miR-449a	CLIP-seq
MIRT1093460	hsa-miR-449b	CLIP-seq
MIRT1093461	hsa-miR-4651	CLIP-seq
MIRT1093462	hsa-miR-541	CLIP-seq
MIRT1093463	hsa-miR-608	CLIP-seq
MIRT1093464	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005871	Component	Kinesin complex	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005929	Component	Cilium	IBA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0005929	Component	Cilium	TAS
GO:0005930	Component	Axoneme	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0015031	Process	Protein transport	IEA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0030030	Process	Cell projection organization	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031503	Process	Protein-containing complex localization	IEA
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0032839	Component	Dendrite cytoplasm	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0098794	Component	Postsynapse	IEA
GO:0098971	Process	Anterograde dendritic transport of neurotransmitter receptor complex	IBA
GO:0098971	Process	Anterograde dendritic transport of neurotransmitter receptor complex	IEA
GO:1990075	Component	Periciliary membrane compartment	IEA

Other IDs

• MIM: 605037
• HGNC: 19167
• e!Ensembl: ENSG00000117245

Protein

• UniProt ID: Q9P2E2
• Protein name: Kinesin-like protein KIF17 (KIF3-related motor protein)
• Protein function: Dendrite-specific motor protein which, in association with the Apba1-containing complex (LIN-10-LIN-2-LIN-7 complex), transports vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules. {ECO:0000250|UniProtKB:Q99
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	11 → 335	Kinesin motor domain	Domain

• Sequence:

  MASEAVKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDGAYHV
  DHVTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPDPPSQRGIIPRAFEH
  VFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQKLELKEHPEKGVYVKGLSMHTVH
  SVAQCEHIMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGKDHLRAGKLNLVD
  LAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGRCKHVPYRDSKLTRLLQDSL
  GGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEEIKKL
  KAILTQQMSPSSLSALLSRQVPPDPVQVEEKLLPQPVIQHDVEAEKQLIREEYEERLARL
  KADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRKETEAVLQVGVLYKAEVMSRAEF
  ASSAEYPPAFQYETVVKPKVFSTTDTLPSDDVSKTQVSSRFAELPKVEPSKSEISLGSSE
  SSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSRYFLDECLGQEAAGHLLGEQNYLPQEE
  PQEVPLQGLLGLQDPFAEVEAKLARLSSTVARTDAPQADVPKVPVQVPAPTDLLEPSDAR
  PEAEAADDFPPRPEVDLASEVALEVVRTAEPGVWLEAQAPVALVAQPEPLPATAGVKRES
  VGMEVAVLTDDPLPVVDQQQVLARLQLLEQQVVGGEQAKNKDLKEKHKRRKRYADERRKQ
  LVAALQNSDEDSGDWVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEK
  IDYLATIRRQERDSMLLQQLLEQVQPLIRRDCNYSNLEKILRESCWDEDNGFWKIPHPVI
  TKTSLPVAVSTGPQNKPARKTSAADNGEPNMEDDRYRLMLSRSNSENIASNYFRSKRASQ
  ILSTDARKSLTHHNSPPGLSCPLSNNSAIPPTQAPEMPQPRPFRLESLDIPFTKAKRKKS
  KSNFGSEPL

• Sequence length: 1029

Pathways

KEGG:

Motor proteins

Reactome:

Intraflagellar transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF17-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33922911	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28881568		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39218304	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	33922911	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25017104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	BEFREE	28341548		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28881568		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	33922911	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28881568		★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 2 (disorder)	Retinitis Pigmentosa	BEFREE	28444310		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20646681, 25354644, 26421900, 31612310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20646681, 25354644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations