Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57559
Gene name	STAM binding protein like 1
Gene symbol	STAMBPL1
Synonyms (NCBI Gene)	ALMalphaAMSH-FPAMSH-LPbA399O19.2
Chromosome	10
Chromosome location	10q23.31

Show/Hide all (74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024279	hsa-miR-215-5p	Microarray	19074876
MIRT026552	hsa-miR-192-5p	Microarray	19074876
MIRT027048	hsa-miR-103a-3p	Sequencing	20371350
MIRT036575	hsa-miR-941	CLASH	23622248
MIRT528487	hsa-miR-5197-5p	PAR-CLIP	22012620
MIRT528485	hsa-miR-548p	PAR-CLIP	22012620
MIRT528484	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT528483	hsa-miR-1248	PAR-CLIP	22012620
MIRT528482	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT528481	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT528479	hsa-miR-6837-3p	PAR-CLIP	22012620
MIRT528480	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT528478	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT528477	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT528476	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT528475	hsa-miR-23c	PAR-CLIP	22012620
MIRT528474	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT512872	hsa-miR-508-5p	PAR-CLIP	23446348
MIRT512871	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT512870	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT512869	hsa-miR-766-3p	PAR-CLIP	23446348
MIRT512868	hsa-miR-4633-5p	PAR-CLIP	23446348
MIRT512867	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT512866	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT528487	hsa-miR-5197-5p	PAR-CLIP	22012620
MIRT528485	hsa-miR-548p	PAR-CLIP	22012620
MIRT528484	hsa-miR-1237-3p	PAR-CLIP	22012620
MIRT528483	hsa-miR-1248	PAR-CLIP	22012620
MIRT528482	hsa-miR-412-3p	PAR-CLIP	22012620
MIRT528481	hsa-miR-6754-3p	PAR-CLIP	22012620
MIRT528479	hsa-miR-6837-3p	PAR-CLIP	22012620
MIRT528480	hsa-miR-4778-3p	PAR-CLIP	22012620
MIRT528478	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT528477	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT528476	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT528475	hsa-miR-23c	PAR-CLIP	22012620
MIRT528474	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT512872	hsa-miR-508-5p	PAR-CLIP	23446348
MIRT512871	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT512870	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT512869	hsa-miR-766-3p	PAR-CLIP	23446348
MIRT512868	hsa-miR-4633-5p	PAR-CLIP	23446348
MIRT512867	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT512866	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT1395006	hsa-miR-103a	CLIP-seq
MIRT1395007	hsa-miR-107	CLIP-seq
MIRT1395008	hsa-miR-1225-5p	CLIP-seq
MIRT1395009	hsa-miR-1301	CLIP-seq
MIRT1395010	hsa-miR-3126-3p	CLIP-seq
MIRT1395011	hsa-miR-3176	CLIP-seq
MIRT1395012	hsa-miR-3187-3p	CLIP-seq
MIRT1395013	hsa-miR-323-3p	CLIP-seq
MIRT1395014	hsa-miR-3591-3p	CLIP-seq
MIRT1395015	hsa-miR-361-5p	CLIP-seq
MIRT1395016	hsa-miR-3922-3p	CLIP-seq
MIRT1395017	hsa-miR-4529-5p	CLIP-seq
MIRT1395018	hsa-miR-4795-3p	CLIP-seq
MIRT1395019	hsa-miR-5047	CLIP-seq
MIRT2634484	hsa-miR-19a	CLIP-seq
MIRT2634485	hsa-miR-19b	CLIP-seq
MIRT2634486	hsa-miR-3120-3p	CLIP-seq
MIRT2634487	hsa-miR-3662	CLIP-seq
MIRT2634488	hsa-miR-3942-5p	CLIP-seq
MIRT2634489	hsa-miR-4703-5p	CLIP-seq
MIRT2634490	hsa-miR-568	CLIP-seq
MIRT2634491	hsa-miR-642b	CLIP-seq
MIRT2634484	hsa-miR-19a	CLIP-seq
MIRT2634485	hsa-miR-19b	CLIP-seq
MIRT2634486	hsa-miR-3120-3p	CLIP-seq
MIRT2634487	hsa-miR-3662	CLIP-seq
MIRT2634488	hsa-miR-3942-5p	CLIP-seq
MIRT2634489	hsa-miR-4703-5p	CLIP-seq
MIRT2634490	hsa-miR-568	CLIP-seq
MIRT2634491	hsa-miR-642b	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21163940, 21516116, 25416956, 32296183, 33961781
GO:0005768	Component	Endosome	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	36528027
GO:0046872	Function	Metal ion binding	IEA
GO:0061578	Function	K63-linked deubiquitinase activity	IBA
GO:0061578	Function	K63-linked deubiquitinase activity	IDA	34425109, 35114100
GO:0061578	Function	K63-linked deubiquitinase activity	IEA
GO:0061578	Function	K63-linked deubiquitinase activity	TAS
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0071233	Process	Cellular response to L-leucine	IDA	35114100
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35114100
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	35114100
GO:1990253	Process	Cellular response to leucine starvation	IDA	35114100

MIM	HGNC	e!Ensembl
612352	24105	ENSG00000138134

Q96FJ0

Protein name

AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1)

Protein function

Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains (PubMed:18758443, PubMed:35114100). Acts as a positive regulator of the TORC1 signaling pathway by mediating 'Lys-63'-linked deubiquitination of SESN2, thereby i

PDB

2ZNR , 2ZNV , 7L97

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08969	USP8_dimer	22 → 132	USP8 dimerisation domain	Domain
PF01398	JAB	264 → 373	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12810066}.

Sequence

MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR

Sequence length

436

Interactions

View interactions

	Reactome
			Metalloprotease DUBs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	22258247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32309439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Familial Thoracic 2	Thoracic Aortic Aneurysm	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Familial Thoracic 6	Aortic Aneurysm	CLINVAR_DG	17994018, 19409525, 19639654, 20734336, 21212136, 21248741, 21288906, 21733706, 21937134, 22752479, 22831780, 22946110, 24020716, 24243736, 24293535 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32636467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	19654303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30360403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	CLINVAR_DG	17994018, 19409525, 19639654, 20734336, 20970362, 21248741, 21733706, 22302747, 22752479, 23099432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32636467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	19654303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31004702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31611951		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOYAMOYA DISEASE 5	Moyamoya Disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MULTISYSTEMIC SMOOTH MUSCLE DYSFUNCTION SYNDROME	Multisystemic Smooth Muscle Dysfunction Syndrome	CLINVAR_DG	20734336, 20970362, 22302747, 22752479, 22831780, 22946110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31004702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30360403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30360403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31611951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33111649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STAMBPL1 (STAM binding protein like 1)