Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57556
Gene name	Semaphorin 6A
Gene symbol	SEMA6A
Synonyms (NCBI Gene)	HT018SEMASEMA6A1SEMAQVIA
Chromosome	5
Chromosome location	5q23.1
Summary	The transmembrane semaphorin SEMA6A is expressed in developing neural tissue and is required for proper development of the thalamocortical projection (Leighton et al., 2001 [PubMed 11242070]).[supplied by OMIM, Feb 2011]

175

Show/Hide all (175)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047836	hsa-miR-30c-5p	CLASH	23622248
MIRT052939	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	22184411
MIRT052940	hsa-miR-27b-3p	ELISALuciferase reporter assayqRT-PCR	22184411
MIRT052939	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	22184411
MIRT052940	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT052940	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT052940	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT052940	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT653991	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT653990	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT653989	hsa-miR-30a-5p	HITS-CLIP	23824327
MIRT653988	hsa-miR-30b-5p	HITS-CLIP	23824327
MIRT047836	hsa-miR-30c-5p	HITS-CLIP	23824327
MIRT653987	hsa-miR-30d-5p	HITS-CLIP	23824327
MIRT653986	hsa-miR-30e-5p	HITS-CLIP	23824327
MIRT653984	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT653985	hsa-miR-147a	HITS-CLIP	23824327
MIRT492395	hsa-miR-103a-3p	PAR-CLIP	23592263
MIRT492394	hsa-miR-107	PAR-CLIP	23592263
MIRT492393	hsa-miR-4289	PAR-CLIP	23592263
MIRT492392	hsa-miR-7156-3p	PAR-CLIP	23592263
MIRT492391	hsa-miR-1301-3p	PAR-CLIP	23592263
MIRT492390	hsa-miR-5047	PAR-CLIP	23592263
MIRT492389	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT492388	hsa-miR-450b-5p	PAR-CLIP	23592263
MIRT492386	hsa-miR-507	PAR-CLIP	23592263
MIRT492387	hsa-miR-557	PAR-CLIP	23592263
MIRT492385	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT492384	hsa-miR-129-5p	PAR-CLIP	23592263
MIRT734260	hsa-miR-21-3p	Immunohistochemistry (IHC)qRT-PCRWestern blotting	31915154
MIRT653991	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT653990	hsa-miR-2114-5p	HITS-CLIP	23824327
MIRT653989	hsa-miR-30a-5p	HITS-CLIP	23824327
MIRT653988	hsa-miR-30b-5p	HITS-CLIP	23824327
MIRT047836	hsa-miR-30c-5p	HITS-CLIP	23824327
MIRT653987	hsa-miR-30d-5p	HITS-CLIP	23824327
MIRT653986	hsa-miR-30e-5p	HITS-CLIP	23824327
MIRT653984	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT653985	hsa-miR-147a	HITS-CLIP	23824327
MIRT492395	hsa-miR-103a-3p	PAR-CLIP	23592263
MIRT492394	hsa-miR-107	PAR-CLIP	23592263
MIRT492393	hsa-miR-4289	PAR-CLIP	23592263
MIRT492392	hsa-miR-7156-3p	PAR-CLIP	23592263
MIRT492391	hsa-miR-1301-3p	PAR-CLIP	23592263
MIRT492390	hsa-miR-5047	PAR-CLIP	23592263
MIRT492389	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT492388	hsa-miR-450b-5p	PAR-CLIP	23592263
MIRT492386	hsa-miR-507	PAR-CLIP	23592263
MIRT492387	hsa-miR-557	PAR-CLIP	23592263
MIRT492385	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT492384	hsa-miR-129-5p	PAR-CLIP	23592263
MIRT1335442	hsa-miR-1275	CLIP-seq
MIRT1335443	hsa-miR-128	CLIP-seq
MIRT1335444	hsa-miR-1299	CLIP-seq
MIRT1335445	hsa-miR-132	CLIP-seq
MIRT1335446	hsa-miR-144	CLIP-seq
MIRT1335447	hsa-miR-147	CLIP-seq
MIRT1335448	hsa-miR-2052	CLIP-seq
MIRT1335449	hsa-miR-210	CLIP-seq
MIRT1335450	hsa-miR-212	CLIP-seq
MIRT1335451	hsa-miR-27a	CLIP-seq
MIRT1335452	hsa-miR-27b	CLIP-seq
MIRT1335453	hsa-miR-297	CLIP-seq
MIRT1335454	hsa-miR-3123	CLIP-seq
MIRT1335455	hsa-miR-3127-5p	CLIP-seq
MIRT1335456	hsa-miR-3151	CLIP-seq
MIRT1335457	hsa-miR-3202	CLIP-seq
MIRT1335458	hsa-miR-3647-3p	CLIP-seq
MIRT1335459	hsa-miR-3665	CLIP-seq
MIRT1335460	hsa-miR-3911	CLIP-seq
MIRT1335461	hsa-miR-3925-5p	CLIP-seq
MIRT1335462	hsa-miR-4433	CLIP-seq
MIRT1335463	hsa-miR-4438	CLIP-seq
MIRT1335464	hsa-miR-4447	CLIP-seq
MIRT1335465	hsa-miR-4459	CLIP-seq
MIRT1335466	hsa-miR-4472	CLIP-seq
MIRT1335467	hsa-miR-4496	CLIP-seq
MIRT1335468	hsa-miR-4525	CLIP-seq
MIRT1335469	hsa-miR-4533	CLIP-seq
MIRT1335470	hsa-miR-4651	CLIP-seq
MIRT1335471	hsa-miR-4661-3p	CLIP-seq
MIRT1335472	hsa-miR-4665-5p	CLIP-seq
MIRT1335473	hsa-miR-4723-5p	CLIP-seq
MIRT1335474	hsa-miR-4735-5p	CLIP-seq
MIRT1335475	hsa-miR-4768-3p	CLIP-seq
MIRT1335476	hsa-miR-4773	CLIP-seq
MIRT1335477	hsa-miR-4777-5p	CLIP-seq
MIRT1335478	hsa-miR-491-5p	CLIP-seq
MIRT1335479	hsa-miR-513a-3p	CLIP-seq
MIRT1335480	hsa-miR-513a-5p	CLIP-seq
MIRT1335481	hsa-miR-518d-5p	CLIP-seq
MIRT1335482	hsa-miR-519b-5p	CLIP-seq
MIRT1335483	hsa-miR-519c-5p	CLIP-seq
MIRT1335484	hsa-miR-520c-5p	CLIP-seq
MIRT1335485	hsa-miR-526a	CLIP-seq
MIRT1335486	hsa-miR-526b	CLIP-seq
MIRT1335487	hsa-miR-544	CLIP-seq
MIRT1335488	hsa-miR-548v	CLIP-seq
MIRT1335489	hsa-miR-556-3p	CLIP-seq
MIRT1335490	hsa-miR-567	CLIP-seq
MIRT1335491	hsa-miR-570	CLIP-seq
MIRT1335492	hsa-miR-578	CLIP-seq
MIRT1335493	hsa-miR-599	CLIP-seq
MIRT1335494	hsa-miR-608	CLIP-seq
MIRT1335495	hsa-miR-625	CLIP-seq
MIRT1335496	hsa-miR-644	CLIP-seq
MIRT1335497	hsa-miR-651	CLIP-seq
MIRT1335498	hsa-miR-657	CLIP-seq
MIRT1335499	hsa-miR-711	CLIP-seq
MIRT1335500	hsa-miR-875-3p	CLIP-seq
MIRT2099165	hsa-miR-103a	CLIP-seq
MIRT1335444	hsa-miR-1299	CLIP-seq
MIRT2099166	hsa-miR-1301	CLIP-seq
MIRT2099167	hsa-miR-141	CLIP-seq
MIRT1335447	hsa-miR-147	CLIP-seq
MIRT2099168	hsa-miR-1913	CLIP-seq
MIRT2099169	hsa-miR-1915	CLIP-seq
MIRT2099170	hsa-miR-200a	CLIP-seq
MIRT1335451	hsa-miR-27a	CLIP-seq
MIRT1335452	hsa-miR-27b	CLIP-seq
MIRT1335453	hsa-miR-297	CLIP-seq
MIRT2099171	hsa-miR-3143	CLIP-seq
MIRT2099172	hsa-miR-3160-5p	CLIP-seq
MIRT1335457	hsa-miR-3202	CLIP-seq
MIRT2099173	hsa-miR-324-3p	CLIP-seq
MIRT2099174	hsa-miR-346	CLIP-seq
MIRT2099175	hsa-miR-3934	CLIP-seq
MIRT2099176	hsa-miR-4288	CLIP-seq
MIRT2099177	hsa-miR-4311	CLIP-seq
MIRT1335469	hsa-miR-4533	CLIP-seq
MIRT1335471	hsa-miR-4661-3p	CLIP-seq
MIRT2099178	hsa-miR-4726-3p	CLIP-seq
MIRT1335480	hsa-miR-513a-5p	CLIP-seq
MIRT1335490	hsa-miR-567	CLIP-seq
MIRT2099179	hsa-miR-632	CLIP-seq
MIRT1335497	hsa-miR-651	CLIP-seq
MIRT1335500	hsa-miR-875-3p	CLIP-seq
MIRT1335443	hsa-miR-128	CLIP-seq
MIRT2099167	hsa-miR-141	CLIP-seq
MIRT1335446	hsa-miR-144	CLIP-seq
MIRT2323960	hsa-miR-1908	CLIP-seq
MIRT2323961	hsa-miR-194	CLIP-seq
MIRT2099170	hsa-miR-200a	CLIP-seq
MIRT1335451	hsa-miR-27a	CLIP-seq
MIRT1335452	hsa-miR-27b	CLIP-seq
MIRT2323962	hsa-miR-4727-5p	CLIP-seq
MIRT2323963	hsa-miR-4769-3p	CLIP-seq
MIRT1335480	hsa-miR-513a-5p	CLIP-seq
MIRT2323964	hsa-miR-663	CLIP-seq
MIRT1335451	hsa-miR-27a	CLIP-seq
MIRT1335452	hsa-miR-27b	CLIP-seq
MIRT1335456	hsa-miR-3151	CLIP-seq
MIRT1335464	hsa-miR-4447	CLIP-seq
MIRT1335466	hsa-miR-4472	CLIP-seq
MIRT1335478	hsa-miR-491-5p	CLIP-seq
MIRT1335480	hsa-miR-513a-5p	CLIP-seq
MIRT2619800	hsa-miR-1283	CLIP-seq
MIRT2099167	hsa-miR-141	CLIP-seq
MIRT2619801	hsa-miR-1827	CLIP-seq
MIRT2099170	hsa-miR-200a	CLIP-seq
MIRT2619802	hsa-miR-2682	CLIP-seq
MIRT2619803	hsa-miR-34a	CLIP-seq
MIRT2619804	hsa-miR-34c-5p	CLIP-seq
MIRT2619805	hsa-miR-3615	CLIP-seq
MIRT2619806	hsa-miR-3654	CLIP-seq
MIRT2619807	hsa-miR-449a	CLIP-seq
MIRT2619808	hsa-miR-449b	CLIP-seq
MIRT2619809	hsa-miR-449c	CLIP-seq
MIRT2619810	hsa-miR-4638-3p	CLIP-seq
MIRT2619811	hsa-miR-4649-3p	CLIP-seq
MIRT2619812	hsa-miR-4712-5p	CLIP-seq
MIRT2619813	hsa-miR-4793-3p	CLIP-seq
MIRT2619814	hsa-miR-598	CLIP-seq
MIRT2619815	hsa-miR-642b	CLIP-seq
MIRT2619816	hsa-miR-770-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NANOG	Unknown	17671748
POU5F1	Unknown	17671748
SOX2	Unknown	17671748

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0005515	Function	Protein binding	IPI	10993894, 32302524
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	NAS	10993894
GO:0007010	Process	Cytoskeleton organization	NAS	10993894
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	10993894
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	NAS	10993894
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	NAS	10993894
GO:0009887	Process	Animal organ morphogenesis	NAS	10993894
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10993894
GO:0016525	Process	Negative regulation of angiogenesis	IGI	24177325
GO:0030154	Process	Cell differentiation	IEA
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030424	Component	Axon	NAS	10993894
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	21536891
GO:0045499	Function	Chemorepellent activity	IBA
GO:0050919	Process	Negative chemotaxis	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	21536891
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0106089	Process	Negative regulation of cell adhesion involved in sprouting angiogenesis	IGI	24177325
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IDA	21536891
GO:1903671	Process	Negative regulation of sprouting angiogenesis	IDA	22184411
GO:2001224	Process	Positive regulation of neuron migration	IBA

MIM	HGNC	e!Ensembl
605885	10738	ENSG00000092421

Q9H2E6

Protein name

Semaphorin-6A (Semaphorin VIA) (Sema VIA) (Semaphorin-6A-1) (SEMA6A-1)

Protein function

Cell surface receptor for PLXNA2 that plays an important role in cell-cell signaling. Required for normal granule cell migration in the developing cerebellum. Promotes reorganization of the actin cytoskeleton and plays an important role in axon

PDB

6WTS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	61 → 480	Sema domain	Family
PF01437	PSI	514 → 569	Plexin repeat	Family

Sequence

MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDALFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYD
GVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERYGKCKKTCIASRDPYCGWIKEGG
ACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESR
GGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILAFV
MGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
AILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGL
SKRLEMHHSSSYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPP
PAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLS
TSMKPNDACT

Sequence length

1030

Interactions

View interactions

	KEGG
	Axon guidance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Delayed puberty, self-limited	Likely pathogenic	rs2532375845	RCV003312987	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (144)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	BEFREE	15666309, 20842734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29104627, 30784343, 30999008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30562713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31420939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29104627, 30784343, 30999008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28928701		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28760529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25405820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30631284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29367676, 31602223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28351000, 28781618, 28784976, 29947505, 30646630, 31410016, 31486496, 31617665, 31721061, 31806729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	29377567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28868796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40248062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29367676, 31602223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29731913, 29989649, 30518871, 30633357, 31342590, 31527696, 31766078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36739418	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30616494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30685348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	20505770, 31389585		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21749583, 25009070, 28580596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21749583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21749583, 25009070, 28580596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29731913, 31032652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	29752711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31639616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26182903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17671748, 31389604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Fibrosis of the Extraocular Muscles	Congenital fibrosis of extraocular muscles	BEFREE	31541710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	29805523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	BEFREE	15666309, 20842734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	15979919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31114997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30651771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	29360985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	18587394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29150301, 29183039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24177325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30825225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30565679, 31337982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29850604, 30549040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	31639451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	15666309, 15979919, 21699693, 22265013, 25277362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31736153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29096379, 31595574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30625365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29965897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30735854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30706740, 31086594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31498480, 31762191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	17671748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	18436822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24865428, 26014517, 29577457, 30319274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26014517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24865428, 26014517, 28736431, 29577457, 30319274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26223576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31539135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen Storage Disease	BEFREE	30228975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	23740775, 24854378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	23740775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	16436660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	LHGDN	16436660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	30270359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29115516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31545933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	30270359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27979766, 30371217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30685348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31590180, 31639616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Neuroaxonal Dystrophy	Neuroaxonal Dystrophy	BEFREE	27395788		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	17685585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30825225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31007750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31704276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27697528, 28262617, 29472529, 30536673, 30605366, 31378885, 31384178, 31423276, 31777531, 31819036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28178643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31527696	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	LHGDN	16436660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26223576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28351000, 28781618, 28784976, 29947505, 30092835, 30646630, 31410016, 31486496, 31617665, 31721061, 31806729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31736153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31498480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29731913, 29989649, 30518871, 30633357, 31342590, 31527696, 31766078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30616494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30893145, 31640781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29091897, 30112020, 30464616, 30745575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29997231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29367676, 31602223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24865428, 28815409, 29721771, 31070723, 31232187, 31266264, 31527696, 31592132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21749583, 25009070, 28580596		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25576923, 28055296, 28590113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35440004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22132072, 30148662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28113081, 29424033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31692760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25405820, 29377567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28886140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31064412		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29348867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30450725, 31227612, 31429119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30929914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15917651, 26014517, 27810643, 28123306, 28588740, 28982852, 29187899, 29784128, 29960820, 29997231, 30092835, 30616494, 30662588, 30863174, 31050894 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30863174		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27395788, 29476864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	30977509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31782614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26448453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevo syndrome (disorder)	Nevo Syndrome	BEFREE	15666309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30735854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30720173, 30949224, 31050363, 31170211, 31579095, 31692094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30735854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31520154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	31337982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	29164563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31049977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30720151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28387888, 28810619, 28839383, 30926679, 30936722, 31696461, 31814757		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30616494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31257410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28515689, 31701892		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	25405820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29917177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive congenital scoliosis	Congenital Scoliosis	BEFREE	25277362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30893145, 31640781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30664260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30806715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28588740, 31482398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29017854, 31389580, 31678279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30631284, 31494772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	24865428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30583806, 31307714, 31318050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30999051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36935366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31709636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29312808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29928443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29091897, 30112020, 30464616, 30745575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33316777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	25405820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tay-Sachs Disease	Tay-Sachs Disease	BEFREE	31293106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29997231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29997231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ullrich congenital muscular dystrophy 1	Ullrich Congenital Muscular Dystrophy	BEFREE	22265013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25405820		★★★★★ ★☆☆☆☆ Found in Text Mining only

SEMA6A (semaphorin 6A)