Gene Gene information from NCBI Gene database.
Entrez ID 57555
Gene name Neuroligin 2
Gene symbol NLGN2
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17p13.1
Summary This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. [provided b
miRNA miRNA information provided by mirtarbase database.
426
miRTarBase ID miRNA Experiments Reference
MIRT043911 hsa-miR-378a-3p CLASH 23622248
MIRT711077 hsa-miR-129-1-3p HITS-CLIP 19536157
MIRT711076 hsa-miR-129-2-3p HITS-CLIP 19536157
MIRT711075 hsa-miR-382-3p HITS-CLIP 19536157
MIRT711074 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
95
GO ID Ontology Definition Evidence Reference
GO:0001966 Process Thigmotaxis IEA
GO:0002087 Process Regulation of respiratory gaseous exchange by nervous system process IEA
GO:0002087 Process Regulation of respiratory gaseous exchange by nervous system process ISS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606479 14290 ENSG00000169992
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFZ4
Protein name Neuroligin-2
Protein function Transmembrane scaffolding protein involved in cell-cell interactions via its interactions with neurexin family members. Mediates cell-cell interactions both in neurons and in other types of cells, such as Langerhans beta cells. Plays a role in s
PDB 5XEQ , 8GS4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00135 COesterase 40 601 Carboxylesterase family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the blood vessel walls. Detected in colon, brain and pancreas islets of Langerhans (at protein level). Detected in brain, and at lower levels in pancreas islet beta cells. {ECO:0000269|PubMed:18755801, ECO:0000269|PubMed:1
Sequence
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
W
LELVPHLHNLHTELFTTTTRLPPYATRWPPRPPAGAPGTRRPPPPATLPPEPEPEPGPR
AYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSGS
GVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDV
PLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
Sequence length 835
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell adhesion molecules   Neurexins and neuroligins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autism Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NLGN2-related disorder Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anxiety Anxiety Disorder BEFREE 27865048
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 27865048
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 22365944, 23393157
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 16077734, 27865048
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 35963640 Associate
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression BEFREE 29339486
★☆☆☆☆
Found in Text Mining only
Developmental Disabilities Developmental disability Pubtator 35468861 Associate
★☆☆☆☆
Found in Text Mining only
Dysmorphic features Dysmorphic Features BEFREE 27865048
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy BEFREE 23393157
★☆☆☆☆
Found in Text Mining only
Hirschsprung Disease Hirschsprung Disease BEFREE 28656720
★☆☆☆☆
Found in Text Mining only