Gene Gene information from NCBI Gene database.
Entrez ID 57541
Gene name Zinc finger protein 398
Gene symbol ZNF398
Synonyms (NCBI Gene)
P51P71ZER6
Chromosome 7
Chromosome location 7q36.1
Summary This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other
miRNA miRNA information provided by mirtarbase database.
202
miRTarBase ID miRNA Experiments Reference
MIRT028302 hsa-miR-32-5p Sequencing 20371350
MIRT050546 hsa-miR-20a-5p CLASH 23622248
MIRT048224 hsa-miR-196a-5p CLASH 23622248
MIRT713003 hsa-miR-519d-5p HITS-CLIP 19536157
MIRT713001 hsa-miR-5695 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 21516116, 25416956, 28514442, 31403225, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618593 18373 ENSG00000197024
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TD17
Protein name Zinc finger protein 398 (Zinc finger DNA-binding protein p52/p71)
Protein function Functions as a transcriptional activator.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12417 DUF3669 43 113 Zinc finger protein Family
PF01352 KRAB 142 183 KRAB box Family
PF00096 zf-C2H2 399 420 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 427 449 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 455 477 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 483 505 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 511 533 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 539 561 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 567 590 Zinc finger, C2H2 type Domain
Sequence
MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIH
SRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRL
ENLENLL
RNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SMD
YAINQPDVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQ
VGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKS
QQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTH
QCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH
NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQE
RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFS
CPHCGKSFIRKHHLMKHQRIH
TGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDP
SGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL
Sequence length 642
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
RETINAL DEGENERATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 15365563, 15916980
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 15365563
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 10935472
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 11179485
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 31521611
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 31521611 Associate
★☆☆☆☆
Found in Text Mining only
Fibroadenoma Fibroadenoma BEFREE 15365563
★☆☆☆☆
Found in Text Mining only
Fibrosarcoma Fibrosarcoma BEFREE 7530025
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 10695992
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 10391684, 15365563, 15916980
★☆☆☆☆
Found in Text Mining only