PTK7 (protein tyrosine kinase 7 (inactive))

Gene

• Entrez ID: 5754
• Gene name: Protein tyrosine kinase 7 (inactive)
• Gene symbol: PTK7
• Synonyms (NCBI Gene): CCK-4, CCK4
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023149	hsa-miR-124-3p	Microarray	18668037
MIRT025958	hsa-miR-7-5p	Sequencing	20371350
MIRT049679	hsa-miR-92a-3p	CLASH	23622248
MIRT043228	hsa-miR-324-5p	CLASH	23622248
MIRT041454	hsa-miR-193b-3p	CLASH	23622248
MIRT491495	hsa-miR-3141	PAR-CLIP	23592263
MIRT491494	hsa-miR-5689	PAR-CLIP	23592263
MIRT491492	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT491493	hsa-miR-6083	PAR-CLIP	23592263
MIRT439870	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439870	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT025958	hsa-miR-7-5p	PAR-CLIP	26701625
MIRT491495	hsa-miR-3141	PAR-CLIP	23592263
MIRT491494	hsa-miR-5689	PAR-CLIP	23592263
MIRT491492	hsa-miR-190a-3p	PAR-CLIP	23592263
MIRT491493	hsa-miR-6083	PAR-CLIP	23592263
MIRT1273604	hsa-miR-3151	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273606	hsa-miR-4447	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT1273608	hsa-miR-4472	CLIP-seq
MIRT1273609	hsa-miR-548n	CLIP-seq
MIRT1273610	hsa-miR-548t	CLIP-seq
MIRT1273611	hsa-miR-555	CLIP-seq
MIRT1273612	hsa-miR-595	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT1273614	hsa-miR-2278	CLIP-seq
MIRT1273615	hsa-miR-3908	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273616	hsa-miR-4267	CLIP-seq
MIRT1273617	hsa-miR-4286	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT1273618	hsa-miR-4461	CLIP-seq
MIRT1273619	hsa-miR-4477a	CLIP-seq
MIRT1273620	hsa-miR-4477b	CLIP-seq
MIRT1273621	hsa-miR-503	CLIP-seq
MIRT1273622	hsa-miR-545	CLIP-seq
MIRT1273623	hsa-miR-548ac	CLIP-seq
MIRT1273624	hsa-miR-548ae	CLIP-seq
MIRT1273625	hsa-miR-548aj	CLIP-seq
MIRT1273626	hsa-miR-548am	CLIP-seq
MIRT1273627	hsa-miR-548d-3p	CLIP-seq
MIRT1273628	hsa-miR-548x	CLIP-seq
MIRT1273629	hsa-miR-548z	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT1273630	hsa-miR-767-3p	CLIP-seq
MIRT2306623	hsa-miR-1207-5p	CLIP-seq
MIRT2306624	hsa-miR-1266	CLIP-seq
MIRT2306625	hsa-miR-1909	CLIP-seq
MIRT2306626	hsa-miR-3127-5p	CLIP-seq
MIRT2306627	hsa-miR-3663-5p	CLIP-seq
MIRT1273605	hsa-miR-3918	CLIP-seq
MIRT1273616	hsa-miR-4267	CLIP-seq
MIRT2306628	hsa-miR-4305	CLIP-seq
MIRT2306629	hsa-miR-4325	CLIP-seq
MIRT2306630	hsa-miR-4436b-3p	CLIP-seq
MIRT1273607	hsa-miR-4459	CLIP-seq
MIRT2306631	hsa-miR-4518	CLIP-seq
MIRT2306632	hsa-miR-4684-3p	CLIP-seq
MIRT2306633	hsa-miR-4761-3p	CLIP-seq
MIRT2306634	hsa-miR-4763-3p	CLIP-seq
MIRT2306635	hsa-miR-500a	CLIP-seq
MIRT2306636	hsa-miR-601	CLIP-seq
MIRT1273613	hsa-miR-665	CLIP-seq
MIRT2604349	hsa-miR-1291	CLIP-seq
MIRT2604350	hsa-miR-3173-5p	CLIP-seq
MIRT2604351	hsa-miR-4753-5p	CLIP-seq
MIRT2604352	hsa-miR-4755-3p	CLIP-seq
MIRT2604349	hsa-miR-1291	CLIP-seq
MIRT2604350	hsa-miR-3173-5p	CLIP-seq
MIRT2604351	hsa-miR-4753-5p	CLIP-seq
MIRT2604352	hsa-miR-4755-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001736	Process	Establishment of planar polarity	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003281	Process	Ventricular septum development	IEA
GO:0003401	Process	Axis elongation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	21132015, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7478540
GO:0005911	Component	Cell-cell junction	IBA
GO:0005911	Component	Cell-cell junction	IDA	20837484
GO:0005911	Component	Cell-cell junction	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007165	Process	Signal transduction	TAS	7478540
GO:0007411	Process	Axon guidance	IEA
GO:0007507	Process	Heart development	IEA
GO:0008046	Function	Axon guidance receptor activity	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0015026	Function	Coreceptor activity	NAS	24431302
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016477	Process	Cell migration	IMP	20837484
GO:0030036	Process	Actin cytoskeleton organization	IMP	20837484
GO:0030424	Component	Axon	IBA
GO:0042060	Process	Wound healing	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IEA
GO:0050808	Process	Synapse organization	IBA
GO:0060026	Process	Convergent extension	IEA
GO:0060484	Process	Lung-associated mesenchyme development	IEA
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IBA
GO:0060976	Process	Coronary vasculature development	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	21132015

Other IDs

• MIM: 601890
• HGNC: 9618
• e!Ensembl: ENSG00000112655

Protein

• UniProt ID: Q13308
• Protein name: Inactive tyrosine-protein kinase 7 (Colon carcinoma kinase 4) (CCK-4) (Protein-tyrosine kinase 7) (Pseudo tyrosine kinase receptor 7) (Tyrosine-protein kinase-like 7)
• Protein function: Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell pola
• PDB: 6VG3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13927	Ig_3	32 → 105		Domain
  PF13927	Ig_3	128 → 204		Domain
  PF13927	Ig_3	226 → 304		Domain
  PF07679	I-set	328 → 408	Immunoglobulin I-set domain	Domain
  PF07679	I-set	412 → 498	Immunoglobulin I-set domain	Domain
  PF13927	Ig_3	503 → 574		Domain
  PF07679	I-set	592 → 681	Immunoglobulin I-set domain	Domain
  PF07714	PK_Tyr_Ser-Thr	796 → 1061	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.
• Sequence:

  MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
  VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
  IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
  KERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYE
  EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
  CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
  VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
  SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR
  CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
  GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
  TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
  RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
  GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
  KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
  LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
  PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
  YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
  AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

• Sequence length: 1070

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PTK7-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28229174, 29556738		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24654231, 31701509		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24654231, 29300342, 31701509		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	31689287		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28229174		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31689287		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20542521		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20542521		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31689287		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24987951		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24409301		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24409301	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37569547	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29556738		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22665490, 27499181, 29867084, 35216506, 37569547	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31730575	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24654231, 24789704		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25550828	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33048956	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31361072	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25032869		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30944666		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30944666		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28229174		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28545451	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	21103379		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22665490	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17671748, 25962058, 29488611		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17671748		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21103379	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22665490, 27499181, 29488611, 35163215	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	38049831	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniorachischisis	Craniorachischisis	BEFREE	26368655		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24789704, 28545451		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24789704, 28545451		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28545451	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23663482	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27557627, 27689325, 28545451, 29867084, 35216506	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	24618420		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	17671748		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37354459	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	31730575	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	34083232	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29989208		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30678306	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24587299, 28545451		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18363322, 19360825, 20558616	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20558616, 30552789		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20558616, 22898210	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21103379	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	14977821, 20558616, 21103379		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	21335544	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	24789704		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25796105, 31730575		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21103379	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40086026	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24987951, 28547980	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27499181, 35257502	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28089349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	31689287		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24409301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24789704, 28545451		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24654231, 24789704		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25032869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24987951		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31820857		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20837484, 24409301, 25796105, 25962058, 26315836, 27557627, 27689325, 28089349, 28924970, 29867084, 30308421, 30348980, 31125531		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30944666		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21103379		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28089349, 29149598, 31655906, 9185712		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29149598	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29149598, 9185712		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	30552789		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24409301, 24587299, 24654231, 24789704, 25962058, 26315836, 28077676, 28442586, 28545451, 29099739, 29867084, 30311693, 30644724, 31361072		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	21415598, 26368655, 30689296		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	29573971, 30689296	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	CTD_human_DG	28191889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	40086026	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24654231		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25032869		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25550828, 34083232, 35977930	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	11803530, 15346539, 18832011, 20542521, 22553078, 22939006, 30149298, 8104032, 8837709		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	10395221, 18832011, 22939006, 8104032, 8837709		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	30341100		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	31361072		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29556738		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18363322, 30311693		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24987951		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24987951	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28442586		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10395221, 11803530		★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	34828397	Associate	★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	26368655, 29573971, 30689296		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28545451		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23663482, 27557627, 27689325, 28545451, 29867084, 31490704		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28547980, 35257502	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24789704		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30348980		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31820857		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21103379	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31820857	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32633373	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24409301, 34083232	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28077676		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37569547	Stimulate	★☆☆☆☆ Found in Text Mining only