Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57512
Gene name	G protein-coupled receptor 158
Gene symbol	GPR158
Synonyms (NCBI Gene)	mGlyR
Chromosome	10
Chromosome location	10p12.1

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT645324	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT645323	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT662812	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT662811	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT645322	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645321	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT645324	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT645323	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT645322	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645321	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT504116	hsa-miR-944	PAR-CLIP	23446348
MIRT504115	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT504114	hsa-miR-4772-3p	PAR-CLIP	23446348
MIRT504113	hsa-miR-4666a-5p	PAR-CLIP	23446348
MIRT504112	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504111	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT645324	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT645323	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT662812	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT662811	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT645322	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645321	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT645324	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT645323	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT645322	hsa-miR-374a-3p	HITS-CLIP	23824327
MIRT645321	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT504116	hsa-miR-944	PAR-CLIP	23446348
MIRT504115	hsa-miR-4699-3p	PAR-CLIP	23446348
MIRT504114	hsa-miR-4772-3p	PAR-CLIP	23446348
MIRT504113	hsa-miR-4666a-5p	PAR-CLIP	23446348
MIRT504112	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT504111	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT1030804	hsa-miR-1	CLIP-seq
MIRT1030805	hsa-miR-1279	CLIP-seq
MIRT1030806	hsa-miR-136	CLIP-seq
MIRT1030807	hsa-miR-203	CLIP-seq
MIRT1030808	hsa-miR-206	CLIP-seq
MIRT1030809	hsa-miR-3121-3p	CLIP-seq
MIRT1030810	hsa-miR-3190	CLIP-seq
MIRT1030811	hsa-miR-3620	CLIP-seq
MIRT1030812	hsa-miR-3646	CLIP-seq
MIRT1030813	hsa-miR-3673	CLIP-seq
MIRT1030814	hsa-miR-3911	CLIP-seq
MIRT1030815	hsa-miR-3973	CLIP-seq
MIRT1030816	hsa-miR-4302	CLIP-seq
MIRT1030817	hsa-miR-4480	CLIP-seq
MIRT1030818	hsa-miR-4659a-3p	CLIP-seq
MIRT1030819	hsa-miR-4659b-3p	CLIP-seq
MIRT1030820	hsa-miR-4666-5p	CLIP-seq
MIRT1030821	hsa-miR-4778-3p	CLIP-seq
MIRT1030822	hsa-miR-4803	CLIP-seq
MIRT1030823	hsa-miR-490-5p	CLIP-seq
MIRT1030824	hsa-miR-513a-3p	CLIP-seq
MIRT1030825	hsa-miR-520g	CLIP-seq
MIRT1030826	hsa-miR-520h	CLIP-seq
MIRT1030827	hsa-miR-548u	CLIP-seq
MIRT1030828	hsa-miR-613	CLIP-seq
MIRT2005817	hsa-miR-2113	CLIP-seq
MIRT2005818	hsa-miR-218	CLIP-seq
MIRT2005819	hsa-miR-3192	CLIP-seq
MIRT2005820	hsa-miR-4731-5p	CLIP-seq
MIRT2005821	hsa-miR-494	CLIP-seq
MIRT2238407	hsa-miR-1183	CLIP-seq
MIRT2238408	hsa-miR-135a	CLIP-seq
MIRT2238409	hsa-miR-135b	CLIP-seq
MIRT2238410	hsa-miR-137	CLIP-seq
MIRT2238411	hsa-miR-2467-3p	CLIP-seq
MIRT2238412	hsa-miR-25	CLIP-seq
MIRT2238413	hsa-miR-32	CLIP-seq
MIRT2238414	hsa-miR-363	CLIP-seq
MIRT2238415	hsa-miR-367	CLIP-seq
MIRT2238416	hsa-miR-3678-3p	CLIP-seq
MIRT2238417	hsa-miR-374a	CLIP-seq
MIRT2238418	hsa-miR-374b	CLIP-seq
MIRT2238419	hsa-miR-3919	CLIP-seq
MIRT2238420	hsa-miR-4307	CLIP-seq
MIRT2238421	hsa-miR-4327	CLIP-seq
MIRT1030820	hsa-miR-4666-5p	CLIP-seq
MIRT2238422	hsa-miR-4670-3p	CLIP-seq
MIRT2238423	hsa-miR-4693-5p	CLIP-seq
MIRT2238424	hsa-miR-550b	CLIP-seq
MIRT2238425	hsa-miR-636	CLIP-seq
MIRT2238426	hsa-miR-92a	CLIP-seq
MIRT2238427	hsa-miR-92b	CLIP-seq
MIRT1030806	hsa-miR-136	CLIP-seq
MIRT1030811	hsa-miR-3620	CLIP-seq
MIRT1030806	hsa-miR-136	CLIP-seq
MIRT1030811	hsa-miR-3620	CLIP-seq
MIRT2450610	hsa-miR-129-5p	CLIP-seq
MIRT2450611	hsa-miR-4470	CLIP-seq
MIRT2450612	hsa-miR-488	CLIP-seq
MIRT2450613	hsa-miR-548an	CLIP-seq
MIRT2542429	hsa-miR-577	CLIP-seq
MIRT2542429	hsa-miR-577	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001956	Process	Positive regulation of neurotransmitter secretion	IEA
GO:0001956	Process	Positive regulation of neurotransmitter secretion	ISS	28851741
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005886	Component	Plasma membrane	IDA	31189666
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	31189666
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008047	Function	Enzyme activator activity	IDA	31189666, 36996198
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IDA	36996198
GO:0016020	Component	Membrane	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	36996198
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0050807	Process	Regulation of synapse organization	ISS
GO:0050890	Process	Cognition	IEA
GO:0050890	Process	Cognition	ISS
GO:0072659	Process	Protein localization to plasma membrane	IDA	31189666
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0160079	Function	G protein-coupled glycine receptor activity	IDA	36996198

MIM	HGNC	e!Ensembl
614573	23689	ENSG00000151025

Q5T848

Protein name

Metabotropic glycine receptor (mGlyR) (G-protein coupled receptor 158)

Protein function

Metabotropic receptor for glycine that controls synapse formation and function in the brain (PubMed:36996198). Acts as an atypical G-protein coupled receptor that recruits and regulates the RGS7-GNB5 complex instead of activating G proteins (Pub

PDB

7EWL , 7EWP , 7EWR , 7SHE , 7SHF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00003	7tm_3	426 → 669	7 transmembrane sweet-taste receptor of 3 GCPR	Family

Sequence

MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAP
WSRSTDGTILAQKLAEEVPMDVASYLYTGDSHQLKRANCSGRYELAGLPGKWPALASAHP
SLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPN
QGPRGLGHSWRRKDGLGGDKSHFKWSPPYLECENGSYKPGWLVTLSSAIYGLQPNLVPEF
RGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYH
PGVLPVNNFRRRGPDQHISGSTKDVSEEAYVCLPCREGCPFCADDSPCFVQEDKYLRLAI
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFR
CILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWF
LIGWTSSVCQNLEKQISLIGQGKTSDHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAV
RTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIG
LLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKK
LYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKEGADHG
TAKGTALIRKNPPESSGNTGKSKEETLKNRVFSLKKSHSTYDHVRDQTEESSSLPTESQE
EETTENSTLESLSGKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKTGHPRTSMLQ
KSLSVIASAKEKTLGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQN
SNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVP
SESKVQKHVSIVASEMEKNPTFSLKEKSHHKPKAAEVCQQSNQKRIDKAEVCLWESQGQS
ILEDEKLLISKTPVLPERAKEENGGQPRAANVCAGQSEELPPKAVASKTENENLNQIGHQ
EKKTSSSEENVRGSYNSSNNFQQPLTSRAEVCPWEFETPAQPNAGRSVALPASSALSANK
IAGPRKEEIWDSFKV

Sequence length

1215

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28881629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40001597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29419376, 30546127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29703844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	GWASCAT_DG	29703844		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Bleeding	Diverticular Bleeding	CTD_human_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863, 30661054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Diseases	Diverticular Diseases	CTD_human_DG	30177863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19472401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31189666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	31189666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29419376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25693195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25693195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29419376, 30546127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25693195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28476931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	23451275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	23451275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31533654	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31204315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25693195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25693195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38420803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29419376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29720725		★★★★★ ★☆☆☆☆ Found in Text Mining only

GPR158 (G protein-coupled receptor 158)