Gene Gene information from NCBI Gene database.
Entrez ID 57506
Gene name Mitochondrial antiviral signaling protein
Gene symbol MAVS
Synonyms (NCBI Gene)
CARDIFIPS-1IPS1VISA
Chromosome 20
Chromosome location 20p13
Summary This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral innate immunity
miRNA miRNA information provided by mirtarbase database.
2536
miRTarBase ID miRNA Experiments Reference
MIRT020812 hsa-miR-155-5p Proteomics 18668040
MIRT049317 hsa-miR-92a-3p CLASH 23622248
MIRT045289 hsa-miR-186-5p CLASH 23622248
MIRT661940 hsa-miR-10a-5p HITS-CLIP 23824327
MIRT661939 hsa-miR-10b-5p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
IRF3 Activation 18207245
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
79
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 21200404
GO:0002218 Process Activation of innate immune response IDA 20628368
GO:0002230 Process Positive regulation of defense response to virus by host IDA 16127453, 20628368
GO:0002230 Process Positive regulation of defense response to virus by host IEA
GO:0002230 Process Positive regulation of defense response to virus by host IMP 19609254
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609676 29233 ENSG00000088888
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z434
Protein name Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA)
Protein function Adapter required for innate immune defense against viruses (PubMed:16125763, PubMed:16127453, PubMed:16153868, PubMed:16177806, PubMed:19631370, PubMed:20127681, PubMed:20451243, PubMed:21170385, PubMed:23087404, PubMed:27992402, PubMed:33139700
PDB 2MS7 , 2MS8 , 2VGQ , 3J6C , 3J6J , 3RC5 , 4P4H , 4Z8M , 5JEK , 7DNI , 8WKW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16739 CARD_2 5 92 Caspase recruitment domain Domain
Tissue specificity TISSUE SPECIFICITY: Present in T-cells, monocytes, epithelial cells and hepatocytes (at protein level). Ubiquitously expressed, with highest levels in heart, skeletal muscle, liver, placenta and peripheral blood leukocytes. {ECO:0000269|PubMed:16125763, E
Sequence
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVY
QSYQPRTSDRPPDPLEPPSLPAERPGPP
TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP
SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLE
GNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Coronavirus disease - COVID-19
  DDX58/IFIH1-mediated induction of interferon-alpha/beta
Ovarian tumor domain proteases
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of DDX58/IFIH1 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 24785255
★☆☆☆☆
Found in Text Mining only
Alloimmunisation Alloimmunisation BEFREE 28630094
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 33628342, 36595748 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases Autoimmune Diseases BEFREE 21268286, 23308066, 27110677, 28141795, 29069650
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune disease Pubtator 36028484 Associate
★☆☆☆☆
Found in Text Mining only
Brain Abscess Brain Abscess BEFREE 21527033
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 23032974
★☆☆☆☆
Found in Text Mining only
Bronchiolitis Bronchiolitis BEFREE 28539639
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 37369480 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Obstructive Airway Disease Chronic Obstructive Pulmonary Disease BEFREE 25938787
★☆☆☆☆
Found in Text Mining only