ADGRB1 (adhesion G protein-coupled receptor B1)

Gene

• Entrez ID: 575
• Gene name: Adhesion G protein-coupled receptor B1
• Gene symbol: ADGRB1
• Synonyms (NCBI Gene): BAI1, GDAIF
• Chromosome: 8
• Chromosome location: 8q24.3
• Summary: Angiogenesis is controlled by a local balance between stimulators and inhibitors of new vessel growth and is suppressed under normal physiologic conditions. Angiogenesis has been shown to be essential for growth and metastasis of solid tumors. In order to

Transcription factors

Transcription factor	Regulation	Reference
MBD2	Unknown	21724586
TP53	Unknown	11875720

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	ISS
GO:0001786	Function	Phosphatidylserine binding	IEA
GO:0001786	Function	Phosphatidylserine binding	ISS
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	23782696
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005515	Function	Protein binding	IPI	9790924, 17960134
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	15782143, 22330140
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26838550
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9647739, 10343108
GO:0005911	Component	Cell-cell junction	TAS	9647739
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	ISS
GO:0006909	Process	Phagocytosis	IEA
GO:0006910	Process	Phagocytosis, recognition	IEA
GO:0006910	Process	Phagocytosis, recognition	ISS
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0007155	Process	Cell adhesion	TAS	9647739
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9647739
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	TAS	10343108
GO:0007422	Process	Peripheral nervous system development	TAS	10343108
GO:0007517	Process	Muscle organ development	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7531056
GO:0010596	Process	Negative regulation of endothelial cell migration	IDA	15782143, 19176395
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	15203201
GO:0016525	Process	Negative regulation of angiogenesis	IDA	15782143, 19176395, 22330140
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0030054	Component	Cell junction	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043277	Process	Apoptotic cell clearance	IMP	24509909
GO:0043652	Process	Engulfment of apoptotic cell	IBA
GO:0043652	Process	Engulfment of apoptotic cell	IEA
GO:0043652	Process	Engulfment of apoptotic cell	IMP	24509909
GO:0043652	Process	Engulfment of apoptotic cell	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045202	Component	Synapse	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	26838550
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IMP	26838550

Other IDs

• MIM: 602682
• HGNC: 943
• e!Ensembl: ENSG00000181790

Protein

• UniProt ID: O14514
• Protein name: Adhesion G protein-coupled receptor B1 (Brain-specific angiogenesis inhibitor 1) [Cleaved into: Vasculostatin-40 (Vstat40); Vasculostatin-120 (Vstat120)]
• Protein function: Phosphatidylserine receptor which enhances the engulfment of apoptotic cells (PubMed:24509909). Also mediates the binding and engulfment of Gram-negative bacteria (PubMed:26838550). Stimulates production of reactive oxygen species by macrophages
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF19188	AGRB_N	41 → 220	Adhesion GPCR B N-terminal region	Family
  PF00090	TSP_1	265 → 314	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	358 → 406	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	413 → 461	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	471 → 519	Thrombospondin type 1 domain	Domain
  PF00090	TSP_1	526 → 574	Thrombospondin type 1 domain	Domain
  PF02793	HRM	578 → 637	Hormone receptor domain	Family
  PF16489	GAIN	661 → 859	GPCR-Autoproteolysis INducing (GAIN) domain	Domain
  PF01825	GPS	882 → 932	GPCR proteolysis site, GPS, motif	Motif
  PF00002	7tm_2	944 → 1180	7 transmembrane receptor (Secretin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain (at protein level) (PubMed:12074842, PubMed:12507886). Expressed on mononuclear phagocytes and monocyte-derived macrophages in the gastric mucosa (at protein level) (PubMed:24509909). Expressed in normal pancreatic t
• Sequence:

  MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
  FPANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
  DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
  PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAV
  AGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCE
  GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
  SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
  CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACS
  ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
  GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
  AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
  GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
  AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
  ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA
  LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
  LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
  TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
  FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
  NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
  VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
  DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
  EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
  GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
  STAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLG
  DPGEPAAHPGPSTGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLN
  RKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRS
  VEWERSGATIPLVGQDIIDLQTEV

• Sequence length: 1584

Pathways

KEGG:

p53 signaling pathway
Efferocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Medulloblastoma	Medulloblastoma	BEFREE	29894688, 31582835		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15225653, 16244591		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29894688, 31582835		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27037190		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10568831, 9772287		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35468861	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12507886, 16244591, 9393972, 9533023		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12507886		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21724586	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12507886, 16244591, 9393972, 9533023		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12507886		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12507886		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11875720		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31153896	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28363643		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23827879		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15846102		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10568831, 11875720, 22330140, 28259299		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29894688, 31582835		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	31582835	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11172604, 11875720, 21509575, 21618836, 22330140, 26129954, 27356780, 29894688		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30004846		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30004846		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15846102		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27270314	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	26129954		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27356780	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22330140		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22330140	Associate	★☆☆☆☆ Found in Text Mining only