AHRR (aryl hydrocarbon receptor repressor)

Gene

• Entrez ID: 57491
• Gene name: Aryl hydrocarbon receptor repressor
• Gene symbol: AHRR
• Synonyms (NCBI Gene): AHH, AHHR, bHLHe77
• Chromosome: 5
• Chromosome location: 5p15.33
• Summary: The protein encoded by this gene participates in the aryl hydrocarbon receptor (AhR) signaling cascade, which mediates dioxin toxicity, and is involved in regulation of cell growth and differentiation. It functions as a feedback modulator by repressing Ah

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002644	hsa-miR-124-3p	Microarray	18668037
MIRT050696	hsa-miR-18a-5p	CLASH	23622248
MIRT050165	hsa-miR-26a-5p	CLASH	23622248
MIRT438200	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay	24176857
MIRT438200	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay	24176857
MIRT438200	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay	24176857
MIRT438200	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay	24176857
MIRT773939	hsa-miR-1205	CLIP-seq
MIRT773940	hsa-miR-124	CLIP-seq
MIRT773941	hsa-miR-1265	CLIP-seq
MIRT773942	hsa-miR-1273f	CLIP-seq
MIRT773943	hsa-miR-1286	CLIP-seq
MIRT773944	hsa-miR-1909	CLIP-seq
MIRT773945	hsa-miR-2392	CLIP-seq
MIRT773946	hsa-miR-3190	CLIP-seq
MIRT773947	hsa-miR-3202	CLIP-seq
MIRT773948	hsa-miR-34a	CLIP-seq
MIRT773949	hsa-miR-34c-5p	CLIP-seq
MIRT773950	hsa-miR-3689d	CLIP-seq
MIRT773951	hsa-miR-4279	CLIP-seq
MIRT773952	hsa-miR-4282	CLIP-seq
MIRT773953	hsa-miR-4436b-3p	CLIP-seq
MIRT773954	hsa-miR-4484	CLIP-seq
MIRT773955	hsa-miR-4493	CLIP-seq
MIRT773956	hsa-miR-449a	CLIP-seq
MIRT773957	hsa-miR-449b	CLIP-seq
MIRT773958	hsa-miR-4509	CLIP-seq
MIRT773959	hsa-miR-4533	CLIP-seq
MIRT773960	hsa-miR-4753-5p	CLIP-seq
MIRT773961	hsa-miR-4802-5p	CLIP-seq
MIRT773962	hsa-miR-485-5p	CLIP-seq
MIRT773963	hsa-miR-488	CLIP-seq
MIRT773964	hsa-miR-506	CLIP-seq
MIRT773965	hsa-miR-516a-3p	CLIP-seq
MIRT773966	hsa-miR-548an	CLIP-seq
MIRT773967	hsa-miR-106a	CLIP-seq
MIRT773968	hsa-miR-106b	CLIP-seq
MIRT773969	hsa-miR-1303	CLIP-seq
MIRT773970	hsa-miR-17	CLIP-seq
MIRT773971	hsa-miR-192	CLIP-seq
MIRT773972	hsa-miR-20a	CLIP-seq
MIRT773973	hsa-miR-20b	CLIP-seq
MIRT773974	hsa-miR-215	CLIP-seq
MIRT773975	hsa-miR-302a	CLIP-seq
MIRT773976	hsa-miR-302b	CLIP-seq
MIRT773977	hsa-miR-302c	CLIP-seq
MIRT773978	hsa-miR-302d	CLIP-seq
MIRT773979	hsa-miR-302e	CLIP-seq
MIRT773980	hsa-miR-3200-3p	CLIP-seq
MIRT773981	hsa-miR-3609	CLIP-seq
MIRT773982	hsa-miR-372	CLIP-seq
MIRT773983	hsa-miR-373	CLIP-seq
MIRT773984	hsa-miR-4473	CLIP-seq
MIRT773985	hsa-miR-4671-3p	CLIP-seq
MIRT773986	hsa-miR-4720-3p	CLIP-seq
MIRT773987	hsa-miR-4731-5p	CLIP-seq
MIRT773988	hsa-miR-4796-3p	CLIP-seq
MIRT773989	hsa-miR-512-3p	CLIP-seq
MIRT773990	hsa-miR-519d	CLIP-seq
MIRT773991	hsa-miR-520a-3p	CLIP-seq
MIRT773992	hsa-miR-520b	CLIP-seq
MIRT773993	hsa-miR-520c-3p	CLIP-seq
MIRT773994	hsa-miR-520d-3p	CLIP-seq
MIRT773995	hsa-miR-520e	CLIP-seq
MIRT773996	hsa-miR-520f	CLIP-seq
MIRT773997	hsa-miR-548ah	CLIP-seq
MIRT773998	hsa-miR-649	CLIP-seq
MIRT773999	hsa-miR-93	CLIP-seq
MIRT773939	hsa-miR-1205	CLIP-seq
MIRT1928409	hsa-miR-1207-5p	CLIP-seq
MIRT1928410	hsa-miR-1254	CLIP-seq
MIRT1928411	hsa-miR-1827	CLIP-seq
MIRT773944	hsa-miR-1909	CLIP-seq
MIRT1928412	hsa-miR-3116	CLIP-seq
MIRT1928413	hsa-miR-330-3p	CLIP-seq
MIRT1928414	hsa-miR-3612	CLIP-seq
MIRT1928415	hsa-miR-3665	CLIP-seq
MIRT1928416	hsa-miR-4252	CLIP-seq
MIRT1928417	hsa-miR-4459	CLIP-seq
MIRT773958	hsa-miR-4509	CLIP-seq
MIRT1928418	hsa-miR-4695-5p	CLIP-seq
MIRT1928419	hsa-miR-4763-3p	CLIP-seq
MIRT1928420	hsa-miR-549	CLIP-seq
MIRT1928421	hsa-miR-558	CLIP-seq
MIRT1928422	hsa-miR-650	CLIP-seq
MIRT1928423	hsa-miR-657	CLIP-seq
MIRT1928424	hsa-miR-661	CLIP-seq
MIRT773939	hsa-miR-1205	CLIP-seq
MIRT2169180	hsa-miR-128	CLIP-seq
MIRT2169181	hsa-miR-1343	CLIP-seq
MIRT1928411	hsa-miR-1827	CLIP-seq
MIRT2169182	hsa-miR-3176	CLIP-seq
MIRT2169183	hsa-miR-3192	CLIP-seq
MIRT1928413	hsa-miR-330-3p	CLIP-seq
MIRT2169184	hsa-miR-3545-3p	CLIP-seq
MIRT1928414	hsa-miR-3612	CLIP-seq
MIRT2169185	hsa-miR-3663-5p	CLIP-seq
MIRT1928415	hsa-miR-3665	CLIP-seq
MIRT2169186	hsa-miR-3689a-3p	CLIP-seq
MIRT2169187	hsa-miR-3689c	CLIP-seq
MIRT2169188	hsa-miR-378g	CLIP-seq
MIRT2169189	hsa-miR-3922-3p	CLIP-seq
MIRT1928416	hsa-miR-4252	CLIP-seq
MIRT2169190	hsa-miR-4446-3p	CLIP-seq
MIRT1928417	hsa-miR-4459	CLIP-seq
MIRT2169191	hsa-miR-4656	CLIP-seq
MIRT2169192	hsa-miR-4663	CLIP-seq
MIRT773985	hsa-miR-4671-3p	CLIP-seq
MIRT2169193	hsa-miR-4680-5p	CLIP-seq
MIRT1928418	hsa-miR-4695-5p	CLIP-seq
MIRT773986	hsa-miR-4720-3p	CLIP-seq
MIRT2169194	hsa-miR-4721	CLIP-seq
MIRT2169195	hsa-miR-4728-5p	CLIP-seq
MIRT1928420	hsa-miR-549	CLIP-seq
MIRT1928421	hsa-miR-558	CLIP-seq
MIRT2169196	hsa-miR-602	CLIP-seq
MIRT1928422	hsa-miR-650	CLIP-seq
MIRT1928423	hsa-miR-657	CLIP-seq
MIRT1928424	hsa-miR-661	CLIP-seq
MIRT773958	hsa-miR-4509	CLIP-seq
MIRT773939	hsa-miR-1205	CLIP-seq
MIRT1928409	hsa-miR-1207-5p	CLIP-seq
MIRT2471793	hsa-miR-1226	CLIP-seq
MIRT773941	hsa-miR-1265	CLIP-seq
MIRT773943	hsa-miR-1286	CLIP-seq
MIRT2169181	hsa-miR-1343	CLIP-seq
MIRT773944	hsa-miR-1909	CLIP-seq
MIRT773945	hsa-miR-2392	CLIP-seq
MIRT2471794	hsa-miR-2861	CLIP-seq
MIRT2471795	hsa-miR-3117-5p	CLIP-seq
MIRT2471796	hsa-miR-3179	CLIP-seq
MIRT2471797	hsa-miR-3189-3p	CLIP-seq
MIRT2169183	hsa-miR-3192	CLIP-seq
MIRT2169186	hsa-miR-3689a-3p	CLIP-seq
MIRT2169187	hsa-miR-3689c	CLIP-seq
MIRT773951	hsa-miR-4279	CLIP-seq
MIRT2471798	hsa-miR-4314	CLIP-seq
MIRT773953	hsa-miR-4436b-3p	CLIP-seq
MIRT1928417	hsa-miR-4459	CLIP-seq
MIRT773958	hsa-miR-4509	CLIP-seq
MIRT2471799	hsa-miR-4512	CLIP-seq
MIRT2471800	hsa-miR-4646-5p	CLIP-seq
MIRT2471801	hsa-miR-4691-3p	CLIP-seq
MIRT2169195	hsa-miR-4728-5p	CLIP-seq
MIRT2471802	hsa-miR-4733-3p	CLIP-seq
MIRT2471803	hsa-miR-4744	CLIP-seq
MIRT1928419	hsa-miR-4763-3p	CLIP-seq
MIRT2471804	hsa-miR-4779	CLIP-seq
MIRT2471805	hsa-miR-4794	CLIP-seq
MIRT773962	hsa-miR-485-5p	CLIP-seq
MIRT2471806	hsa-miR-548m	CLIP-seq
MIRT2471807	hsa-miR-593	CLIP-seq
MIRT2471808	hsa-miR-635	CLIP-seq
MIRT2471809	hsa-miR-665	CLIP-seq
MIRT1928409	hsa-miR-1207-5p	CLIP-seq
MIRT2471793	hsa-miR-1226	CLIP-seq
MIRT773941	hsa-miR-1265	CLIP-seq
MIRT2674770	hsa-miR-1266	CLIP-seq
MIRT773944	hsa-miR-1909	CLIP-seq
MIRT2674771	hsa-miR-1915	CLIP-seq
MIRT773945	hsa-miR-2392	CLIP-seq
MIRT2674772	hsa-miR-3127-5p	CLIP-seq
MIRT2674773	hsa-miR-3155	CLIP-seq
MIRT2674774	hsa-miR-3155b	CLIP-seq
MIRT2471797	hsa-miR-3189-3p	CLIP-seq
MIRT2169183	hsa-miR-3192	CLIP-seq
MIRT2674775	hsa-miR-3613-3p	CLIP-seq
MIRT2674776	hsa-miR-3664-3p	CLIP-seq
MIRT2169186	hsa-miR-3689a-3p	CLIP-seq
MIRT2169187	hsa-miR-3689c	CLIP-seq
MIRT2674777	hsa-miR-3918	CLIP-seq
MIRT773951	hsa-miR-4279	CLIP-seq
MIRT773952	hsa-miR-4282	CLIP-seq
MIRT2471798	hsa-miR-4314	CLIP-seq
MIRT1928417	hsa-miR-4459	CLIP-seq
MIRT773958	hsa-miR-4509	CLIP-seq
MIRT2471799	hsa-miR-4512	CLIP-seq
MIRT2674778	hsa-miR-4518	CLIP-seq
MIRT2471800	hsa-miR-4646-5p	CLIP-seq
MIRT2674779	hsa-miR-4726-3p	CLIP-seq
MIRT2169195	hsa-miR-4728-5p	CLIP-seq
MIRT2471802	hsa-miR-4733-3p	CLIP-seq
MIRT2471803	hsa-miR-4744	CLIP-seq
MIRT1928419	hsa-miR-4763-3p	CLIP-seq
MIRT2471804	hsa-miR-4779	CLIP-seq
MIRT2674780	hsa-miR-484	CLIP-seq
MIRT2674781	hsa-miR-486-5p	CLIP-seq
MIRT773963	hsa-miR-488	CLIP-seq
MIRT773965	hsa-miR-516a-3p	CLIP-seq
MIRT2471806	hsa-miR-548m	CLIP-seq
MIRT2471808	hsa-miR-635	CLIP-seq
MIRT2471809	hsa-miR-665	CLIP-seq
MIRT2674782	hsa-miR-720	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Activation	18848529

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	28904176
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0034751	Component	Aryl hydrocarbon receptor complex	IBA
GO:0046983	Function	Protein dimerization activity	IEA

Other IDs

• MIM: 606517
• HGNC: 346
• e!Ensembl: ENSG00000063438

Protein

• UniProt ID: A9YTQ3
• Protein name: Aryl hydrocarbon receptor repressor (AhR repressor) (AhRR) (Class E basic helix-loop-helix protein 77) (bHLHe77)
• Protein function: Mediates dioxin toxicity and is involved in regulation of cell growth and differentiation. Represses the transcription activity of AHR by competing with this transcription factor for heterodimer formation with the ARNT and subsequently binding t
• PDB: 5Y7Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	33 → 80	Helix-loop-helix DNA-binding domain	Domain
  PF00989	PAS	114 → 187	PAS fold	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis, lung, ovary, spleen and pancreas. Highly expressed in mononuclear cells (MNCs) from umbilical cord blood. Isoform 3 is highly expressed in lung, kidney, spleen and thymus. Down-regulated malignant tissue fro
• Sequence:

  MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPD
  IISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLL
  ESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMD
  PPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFL
  TMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADT
  AATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCL
  RGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRL
  QPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQV
  HPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKME
  KDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQP
  HGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVK
  REPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP

• Sequence length: 701

Pathways

Reactome:

PPARA activates gene expression
Phase I - Functionalization of compounds
Endogenous sterols
Xenobiotics
Aryl hydrocarbon receptor signalling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Angiofibroma	Angiofibroma	BEFREE	22337624, 27633981, 28759137		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26307030, 30915882		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28403070, 34302046, 35309329	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26307030, 30915882		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30915882, 35039093	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	17559847	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16755028, 18565642, 2384269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16755028	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28681081	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22412903, 36093686	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12777964, 18172554, 26667048, 27632354, 28453567, 29262847, 29722794, 30730943, 31060609, 31369996, 31549173		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31369996		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31369996	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28485216, 29395338		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	28425186	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38001042, 38238335	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27262846		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	38001042	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	31868801	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28485216		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28485216		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11393538, 16084889, 17513317, 19501819		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16084889, 17513317		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16084889, 17513317, 19501819, 32295439	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	27977510	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32801256	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	32663496	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	15474075, 17559847	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	38238335	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22337624		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23648678		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	30343628, 30915882	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30915882		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12777964		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27632354, 27924164, 28100713, 28453567, 29262847, 29722794, 30730943, 31060609, 31369996, 32962699, 37150141, 37442331, 37691855	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26362870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16755028, 18565642, 2384269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12777964, 18172554, 26667048, 27632354, 28453567, 29262847, 29722794, 30730943, 31060609, 31369996, 31549173		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23648678		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30087718		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23648678		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27262846		★☆☆☆☆ Found in Text Mining only
Micropenis	Micropenis	BEFREE	15758562		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36359818	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23648678	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29109506		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18172554, 22232023, 23583445, 23648678, 27262846, 27633981, 28759137, 31035533		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26252179		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26252179	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37511212	Associate	★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	BEFREE	15758562		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33124502	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	9330620		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28100713, 30940135, 36359818	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22337624		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	28759137		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30087718		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22952704	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36093686	Associate	★☆☆☆☆ Found in Text Mining only