PTK2 (protein tyrosine kinase 2)

Gene

• Entrez ID: 5747
• Gene name: Protein tyrosine kinase 2
• Gene symbol: PTK2
• Synonyms (NCBI Gene): FADK, FADK 1, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
• Chromosome: 8
• Chromosome location: 8q24.3
• Summary: This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004001	hsa-miR-193a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18381414
MIRT006388	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21444814
MIRT006388	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21444814
MIRT006388	hsa-miR-138-5p	Luciferase reporter assay, Western blot	21444814
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT006900	hsa-miR-7-5p	T47D	22876288
MIRT030918	hsa-miR-21-5p	Microarray	18591254
MIRT051867	hsa-let-7c-5p	CLASH	23622248
MIRT051491	hsa-let-7e-5p	CLASH	23622248
MIRT053172	hsa-miR-543	Luciferase reporter assay, Western blot	24699721
MIRT732163	hsa-miR-379-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26944318
MIRT732163	hsa-miR-379-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26944318
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27764812
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27764812
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay	25785020
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay	25785020
MIRT006900	hsa-miR-7-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31522588
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273415	hsa-miR-1236	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT1273417	hsa-miR-1264	CLIP-seq
MIRT1273418	hsa-miR-1273	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273422	hsa-miR-1301	CLIP-seq
MIRT1273423	hsa-miR-1305	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273431	hsa-miR-186	CLIP-seq
MIRT1273432	hsa-miR-196a	CLIP-seq
MIRT1273433	hsa-miR-196b	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273439	hsa-miR-2115	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT1273445	hsa-miR-3074-5p	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273461	hsa-miR-3690	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273466	hsa-miR-3940-5p	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273469	hsa-miR-4254	CLIP-seq
MIRT1273470	hsa-miR-4268	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273472	hsa-miR-4279	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT1273474	hsa-miR-4436b-5p	CLIP-seq
MIRT1273475	hsa-miR-4448	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273477	hsa-miR-4476	CLIP-seq
MIRT1273478	hsa-miR-4507	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273480	hsa-miR-451b	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273485	hsa-miR-4660	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273490	hsa-miR-4696	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273505	hsa-miR-5047	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273508	hsa-miR-516a-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273511	hsa-miR-544	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT1273513	hsa-miR-548a-3p	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273516	hsa-miR-548ae	CLIP-seq
MIRT1273517	hsa-miR-548ag	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273519	hsa-miR-548ai	CLIP-seq
MIRT1273520	hsa-miR-548aj	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273522	hsa-miR-548am	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273527	hsa-miR-548e	CLIP-seq
MIRT1273528	hsa-miR-548f	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273534	hsa-miR-548x	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT1273539	hsa-miR-583	CLIP-seq
MIRT1273540	hsa-miR-607	CLIP-seq
MIRT1273541	hsa-miR-609	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273543	hsa-miR-629	CLIP-seq
MIRT1273544	hsa-miR-635	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT2080422	hsa-miR-1261	CLIP-seq
MIRT1273418	hsa-miR-1273	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT2080423	hsa-miR-1322	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080425	hsa-miR-145	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273431	hsa-miR-186	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT2080431	hsa-miR-3529	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT2080432	hsa-miR-379	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080434	hsa-miR-4426	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT2080436	hsa-miR-4451	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273480	hsa-miR-451b	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT2080438	hsa-miR-4647	CLIP-seq
MIRT2080439	hsa-miR-4650-3p	CLIP-seq
MIRT2080440	hsa-miR-4662b	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273490	hsa-miR-4696	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2080442	hsa-miR-4720-3p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT2080443	hsa-miR-4782-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT2080444	hsa-miR-4804-3p	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273539	hsa-miR-583	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT2080449	hsa-miR-622	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273410	hsa-miR-106a	CLIP-seq
MIRT1273411	hsa-miR-106b	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273415	hsa-miR-1236	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT2080422	hsa-miR-1261	CLIP-seq
MIRT1273419	hsa-miR-1279	CLIP-seq
MIRT1273420	hsa-miR-1283	CLIP-seq
MIRT2306589	hsa-miR-1290	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273422	hsa-miR-1301	CLIP-seq
MIRT1273425	hsa-miR-1343	CLIP-seq
MIRT1273426	hsa-miR-135a	CLIP-seq
MIRT1273427	hsa-miR-135b	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080425	hsa-miR-145	CLIP-seq
MIRT1273429	hsa-miR-17	CLIP-seq
MIRT1273430	hsa-miR-1825	CLIP-seq
MIRT1273432	hsa-miR-196a	CLIP-seq
MIRT1273433	hsa-miR-196b	CLIP-seq
MIRT1273434	hsa-miR-1976	CLIP-seq
MIRT1273435	hsa-miR-199a-5p	CLIP-seq
MIRT1273436	hsa-miR-199b-5p	CLIP-seq
MIRT1273437	hsa-miR-20a	CLIP-seq
MIRT1273438	hsa-miR-20b	CLIP-seq
MIRT1273439	hsa-miR-2115	CLIP-seq
MIRT1273440	hsa-miR-221	CLIP-seq
MIRT1273441	hsa-miR-222	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273442	hsa-miR-25	CLIP-seq
MIRT2306590	hsa-miR-2681	CLIP-seq
MIRT1273443	hsa-miR-300	CLIP-seq
MIRT1273446	hsa-miR-3119	CLIP-seq
MIRT1273448	hsa-miR-3143	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT2306591	hsa-miR-3167	CLIP-seq
MIRT1273450	hsa-miR-3179	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273452	hsa-miR-32	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT2080431	hsa-miR-3529	CLIP-seq
MIRT1273454	hsa-miR-3607-3p	CLIP-seq
MIRT1273455	hsa-miR-3609	CLIP-seq
MIRT1273456	hsa-miR-3613-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273459	hsa-miR-363	CLIP-seq
MIRT1273460	hsa-miR-367	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT2080432	hsa-miR-379	CLIP-seq
MIRT1273463	hsa-miR-381	CLIP-seq
MIRT1273464	hsa-miR-3925-3p	CLIP-seq
MIRT2306592	hsa-miR-3973	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273472	hsa-miR-4279	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080434	hsa-miR-4426	CLIP-seq
MIRT2306593	hsa-miR-4427	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273474	hsa-miR-4436b-5p	CLIP-seq
MIRT2306594	hsa-miR-4446-3p	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273477	hsa-miR-4476	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273483	hsa-miR-4646-5p	CLIP-seq
MIRT2080438	hsa-miR-4647	CLIP-seq
MIRT1273484	hsa-miR-4654	CLIP-seq
MIRT1273485	hsa-miR-4660	CLIP-seq
MIRT2080440	hsa-miR-4662b	CLIP-seq
MIRT2306595	hsa-miR-4675	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT2306596	hsa-miR-4680-3p	CLIP-seq
MIRT1273489	hsa-miR-4687-3p	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2306597	hsa-miR-4703-3p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT2306598	hsa-miR-4741	CLIP-seq
MIRT1273495	hsa-miR-4747-5p	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT2306599	hsa-miR-4762-3p	CLIP-seq
MIRT1273498	hsa-miR-4764-3p	CLIP-seq
MIRT1273499	hsa-miR-4768-5p	CLIP-seq
MIRT1273500	hsa-miR-4769-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT2080443	hsa-miR-4782-5p	CLIP-seq
MIRT1273502	hsa-miR-4796-3p	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273505	hsa-miR-5047	CLIP-seq
MIRT1273506	hsa-miR-505	CLIP-seq
MIRT1273507	hsa-miR-508-5p	CLIP-seq
MIRT1273508	hsa-miR-516a-3p	CLIP-seq
MIRT1273509	hsa-miR-519d	CLIP-seq
MIRT2306600	hsa-miR-520g	CLIP-seq
MIRT2306601	hsa-miR-520h	CLIP-seq
MIRT1273510	hsa-miR-539	CLIP-seq
MIRT1273511	hsa-miR-544	CLIP-seq
MIRT1273513	hsa-miR-548a-3p	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273516	hsa-miR-548ae	CLIP-seq
MIRT1273517	hsa-miR-548ag	CLIP-seq
MIRT1273518	hsa-miR-548ah	CLIP-seq
MIRT1273519	hsa-miR-548ai	CLIP-seq
MIRT1273520	hsa-miR-548aj	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273522	hsa-miR-548am	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273527	hsa-miR-548e	CLIP-seq
MIRT1273528	hsa-miR-548f	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273532	hsa-miR-548v	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273534	hsa-miR-548x	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT1273541	hsa-miR-609	CLIP-seq
MIRT2080449	hsa-miR-622	CLIP-seq
MIRT1273542	hsa-miR-624	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273547	hsa-miR-7	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT2306602	hsa-miR-876-5p	CLIP-seq
MIRT1273549	hsa-miR-891b	CLIP-seq
MIRT1273550	hsa-miR-92a	CLIP-seq
MIRT1273551	hsa-miR-92b	CLIP-seq
MIRT1273552	hsa-miR-93	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273412	hsa-miR-1197	CLIP-seq
MIRT1273414	hsa-miR-1224-5p	CLIP-seq
MIRT1273416	hsa-miR-1238	CLIP-seq
MIRT1273428	hsa-miR-138	CLIP-seq
MIRT1273447	hsa-miR-3123	CLIP-seq
MIRT1273449	hsa-miR-3165	CLIP-seq
MIRT1273451	hsa-miR-3190	CLIP-seq
MIRT1273453	hsa-miR-3202	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273465	hsa-miR-3925-5p	CLIP-seq
MIRT1273476	hsa-miR-4456	CLIP-seq
MIRT1273482	hsa-miR-4533	CLIP-seq
MIRT1273496	hsa-miR-4751	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273545	hsa-miR-639	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273548	hsa-miR-720	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273421	hsa-miR-1298	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT2080423	hsa-miR-1322	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273462	hsa-miR-3714	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT2080442	hsa-miR-4720-3p	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273493	hsa-miR-4736	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT2604306	hsa-miR-4775	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT2080444	hsa-miR-4804-3p	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT1273514	hsa-miR-548a-5p	CLIP-seq
MIRT1273515	hsa-miR-548ab	CLIP-seq
MIRT1273521	hsa-miR-548ak	CLIP-seq
MIRT1273523	hsa-miR-548an	CLIP-seq
MIRT1273524	hsa-miR-548b-5p	CLIP-seq
MIRT1273525	hsa-miR-548c-5p	CLIP-seq
MIRT1273526	hsa-miR-548d-5p	CLIP-seq
MIRT1273529	hsa-miR-548h	CLIP-seq
MIRT1273530	hsa-miR-548i	CLIP-seq
MIRT1273531	hsa-miR-548j	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT1273533	hsa-miR-548w	CLIP-seq
MIRT1273535	hsa-miR-548y	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273536	hsa-miR-559	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT2604307	hsa-miR-590-3p	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq
MIRT1273553	hsa-miR-940	CLIP-seq
MIRT1273413	hsa-miR-1200	CLIP-seq
MIRT1273423	hsa-miR-1305	CLIP-seq
MIRT1273424	hsa-miR-1321	CLIP-seq
MIRT2080424	hsa-miR-139-5p	CLIP-seq
MIRT2080426	hsa-miR-2116	CLIP-seq
MIRT2080427	hsa-miR-23a	CLIP-seq
MIRT2080428	hsa-miR-23b	CLIP-seq
MIRT2080429	hsa-miR-23c	CLIP-seq
MIRT1273444	hsa-miR-3065-5p	CLIP-seq
MIRT2080430	hsa-miR-3187-3p	CLIP-seq
MIRT1273457	hsa-miR-361-3p	CLIP-seq
MIRT1273458	hsa-miR-3617	CLIP-seq
MIRT1273467	hsa-miR-3977	CLIP-seq
MIRT1273468	hsa-miR-4251	CLIP-seq
MIRT1273471	hsa-miR-4273	CLIP-seq
MIRT1273473	hsa-miR-4324	CLIP-seq
MIRT2080433	hsa-miR-433	CLIP-seq
MIRT2080435	hsa-miR-4435	CLIP-seq
MIRT1273479	hsa-miR-4509	CLIP-seq
MIRT1273481	hsa-miR-4528	CLIP-seq
MIRT2080437	hsa-miR-4529-5p	CLIP-seq
MIRT1273486	hsa-miR-4677-3p	CLIP-seq
MIRT1273487	hsa-miR-4677-5p	CLIP-seq
MIRT1273488	hsa-miR-4679	CLIP-seq
MIRT1273491	hsa-miR-4698	CLIP-seq
MIRT2080441	hsa-miR-4701-5p	CLIP-seq
MIRT1273492	hsa-miR-4728-5p	CLIP-seq
MIRT1273494	hsa-miR-4739	CLIP-seq
MIRT1273497	hsa-miR-4756-5p	CLIP-seq
MIRT1273501	hsa-miR-4778-5p	CLIP-seq
MIRT1273503	hsa-miR-4803	CLIP-seq
MIRT1273504	hsa-miR-495	CLIP-seq
MIRT1273512	hsa-miR-544b	CLIP-seq
MIRT2080445	hsa-miR-548s	CLIP-seq
MIRT2080446	hsa-miR-551a	CLIP-seq
MIRT2080447	hsa-miR-551b	CLIP-seq
MIRT1273537	hsa-miR-580	CLIP-seq
MIRT1273538	hsa-miR-582-5p	CLIP-seq
MIRT2080448	hsa-miR-588	CLIP-seq
MIRT1273540	hsa-miR-607	CLIP-seq
MIRT1273546	hsa-miR-641	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	TAS	20552554
GO:0001725	Component	Stress fiber	IDA	24036928
GO:0001890	Process	Placenta development	TAS	20552554
GO:0001932	Process	Regulation of protein phosphorylation	IGI	19913511
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	15166238
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0003007	Process	Heart morphogenesis	TAS	20552554
GO:0003779	Function	Actin binding	IDA	16803572
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	12235133, 12391143, 14676198
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	10655584, 11331870
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	9360983
GO:0005178	Function	Integrin binding	IPI	26763945
GO:0005515	Function	Protein binding	IPI	7561682, 7597091, 8649368, 9285683, 9756887, 9786953, 10655584, 10822899, 11331870, 14688263, 15657067, 15855171, 16291744, 16354697, 16803572, 16966330, 17525734, 18256281, 18497331, 18560762, 18835089, 19494199, 19732724, 19857493, 19917054, 20473329, 20576130, 21034468, 21266176
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	15855171
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	15855171
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	10801330
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	10655584, 15855171, 23574715
GO:0005925	Component	Focal adhesion	IEA
GO:0005929	Component	Cilium	IDA
GO:0005938	Component	Cell cortex	IEA
GO:0007172	Process	Signal complex assembly	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	11331870
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	9636140, 15725728
GO:0007411	Process	Axon guidance	TAS	15725728
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	10655584, 15166238
GO:0008432	Function	JUN kinase binding	IDA	10925297
GO:0010594	Process	Regulation of endothelial cell migration	TAS	20552554
GO:0010632	Process	Regulation of epithelial cell migration	IGI	19913511
GO:0010634	Process	Positive regulation of epithelial cell migration	IGI	26944318
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IGI	26944318
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IGI	26754294
GO:0010763	Process	Positive regulation of fibroblast migration	IDA	26763945
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IMP	20305651, 26934001
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	10655584, 11331870
GO:0019901	Function	Protein kinase binding	IPI	19118217
GO:0019903	Function	Protein phosphatase binding	IPI	28759036
GO:0022408	Process	Negative regulation of cell-cell adhesion	IDA	21703394
GO:0030010	Process	Establishment of cell polarity	TAS	19525103
GO:0030154	Process	Cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IBA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	11331870, 21703394
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IDA	10655584
GO:0035995	Process	Detection of muscle stretch	TAS	30568254
GO:0036064	Component	Ciliary basal body	IDA	31630787
GO:0038007	Process	Netrin-activated signaling pathway	TAS	15725728
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042127	Process	Regulation of cell population proliferation	IMP	18206965
GO:0042169	Function	SH2 domain binding	IPI	15077193
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	15166238
GO:0043087	Process	Regulation of GTPase activity	TAS	19525103
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045667	Process	Regulation of osteoblast differentiation	IMP	16927379
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	11331870
GO:0046777	Process	Protein autophosphorylation	IDA	10655584, 11331870
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	10655584
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048870	Process	Cell motility	TAS	15725728
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	15725728
GO:0051893	Process	Regulation of focal adhesion assembly	IGI	19913511
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	16919435, 19525103
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	26944318
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	15166238
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0070161	Component	Anchoring junction	IEA
GO:0090303	Process	Positive regulation of wound healing	IDA	26763945
GO:0097706	Process	Vascular endothelial cell response to oscillatory fluid shear stress	TAS
GO:0120041	Process	Positive regulation of macrophage proliferation	IGI	26754294
GO:0140677	Function	Molecular function activator activity	EXP	12467573
GO:1900024	Process	Regulation of substrate adhesion-dependent cell spreading	IGI	19913511
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS
GO:2000811	Process	Negative regulation of anoikis	IMP	22402981

Other IDs

• MIM: 600758
• HGNC: 9611
• e!Ensembl: ENSG00000169398

Protein

• UniProt ID: Q05397
• Protein name: Focal adhesion kinase 1 (FADK 1) (EC 2.7.10.2) (Focal adhesion kinase-related nonkinase) (FRNK) (Protein phosphatase 1 regulatory subunit 71) (PPP1R71) (Protein-tyrosine kinase 2) (p125FAK) (pp125FAK)
• Protein function: Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progress
• PDB: 1K04, 1K05, 1MP8, 1OW6, 1OW7, 1OW8, 2ETM, 2IJM, 3B71, 3BZ3, 3PXK, 3S9O, 4EBV, 4EBW, 4GU6, 4GU9, 4I4E, 4I4F, 4K8A, 4K9Y, 4KAB, 4KAO, 4NY0, 4Q9S, 6I8Z, 6LES, 6PW8, 6YOJ, 6YQ1, 6YR9, 6YT6, 6YVS, 6YVY, 6YXV, 7PI4, 7W7Z, 7W8B, 7W8I, 7W9U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18038	FERM_N_2	35 → 130	FERM N-terminal domain	Domain
  PF00373	FERM_M	133 → 258	FERM central domain	Domain
  PF07714	PK_Tyr_Ser-Thr	422 → 676	Protein tyrosine and serine/threonine kinase	Domain
  PF03623	Focal_AT	914 → 1046	Focal adhesion targeting region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level) (PubMed:31630787). {ECO:0000269|PubMed:20109444, ECO:0000269|Pub
• Sequence:

  MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
  ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
  KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
  WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
  LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
  TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
  RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
  RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
  PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
  RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
  SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
  YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
  PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
  IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
  RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
  GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
  LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
  LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH

• Sequence length: 1052

Pathways

KEGG:

Endocrine resistance
ErbB signaling pathway
Chemokine signaling pathway
Efferocytosis
PI3K-Akt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Growth hormone synthesis, secretion and action
Bacterial invasion of epithelial cells
Shigellosis
Yersinia infection
Amoebiasis
Human cytomegalovirus infection
Human papillomavirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Chemical carcinogenesis - reactive oxygen species
Small cell lung cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Apoptotic cleavage of cellular proteins
Regulation of actin dynamics for phagocytic cup formation
Integrin signaling
GRB2:SOS provides linkage to MAPK signaling for Integrins
p130Cas linkage to MAPK signaling for integrins
NCAM signaling for neurite out-growth
EPHB-mediated forward signaling
DCC mediated attractive signaling
VEGFA-VEGFR2 Pathway
RHO GTPases Activate WASPs and WAVEs
RAF/MAP kinase cascade
MET activates PTK2 signaling
Extra-nuclear estrogen signaling
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BYZANTHINE ARCH PALATE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLASS III MALOCCLUSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL EPICANTHUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL INFECTIOUS DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11585739, 25280968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18263593		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29135089		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23995859, 31036704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15118593		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10523844		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36039594	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26191169		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26119934	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Tortuosity Syndrome	Arterial tortuosity syndrome	Pubtator	26376865	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17963503, 23918525	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28402030		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30737985	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10029102, 11069767		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34619327	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	23593175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21703394	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	24227778	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26786295, 30614803, 30808674		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	19604240	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34702773	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16136050, 16288304, 17849451, 21071137, 22824793, 23894398, 29630900, 29684708, 29796177, 30055645, 31060777, 31080076, 31480645, 31671408, 31706682, 31760124		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10047444, 10400703, 10899173, 12167618, 12659633, 14629195, 15743500, 15861214, 16136050, 16457699, 17515959, 17537730, 18383836, 19029090, 19364917, 19521985, 20159588, 20198306, 20201928, 21281808, 21884573, 22937096, 23485561, 24121667, 24467886, 24693876, 24880126, 24885257, 24885534, 25326692, 25749031, 25778692, 25973915, 26342198, 27094578, 27251275, 27462783, 27773611, 28050799, 29039492, 29382358, 29915029, 29941860, 30055645, 30089167, 30318519, 30728047, 30808745, 30981841, 31306109, 32872257, 33006750, 33008904, 33107920, 33225939, 33668531, 34237080, 35442400, 35538070, 36088502, 36323529, 36604412, 39671698	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16288304	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	29749523	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	29066351		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12174366, 15132756, 15483349, 15861214, 20724588, 26119934, 26393679, 29777904, 36156852, 36857183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31671889	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	20407018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15483349	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28881794		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18695939, 32806748	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18948272, 18997105, 24498348, 24516351, 24912675, 25978354, 26204832, 26443539, 27145276, 28475688, 29506532, 33182805, 33589614, 34108451, 35127170, 35154476, 35197323, 36609600, 37554278, 37787401	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27465549	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	15483349	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26786295, 30614803, 30808674		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27373675, 29654156		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24161487, 28068967, 28351346, 28759022, 28991240, 29048635, 31706682, 31791326		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	15161045	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18353772, 24655477, 31062766	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26119934	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26191169, 30206226, 30747824, 32580737, 32705304, 33025708, 35628269	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23139422, 25805832, 27220961, 28418903, 30816490, 30975094, 31902920, 37009792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34745115	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15132756, 18349846, 34263914, 36499729	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25280968	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19395869, 22272086, 22400488, 23275034, 24755674, 25724667, 28990249, 29743815, 29890142, 31290719, 31478830		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16202218	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36598836	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	23749989		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16270396		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25012246, 33507702, 34971568, 36154723	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29642406		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24916506, 7692878		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	23726144		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36039594	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10523844, 19904749, 25857463, 26648422, 27644693		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12939401, 14699482, 16998832, 17999388		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16461767, 16886596, 25922072, 29135089	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19904749, 20811717, 21707509, 28953264, 29135089, 31676872		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15750208, 16920698, 17848589, 17898132, 18805444, 21209368, 21968138, 22934709, 24946134, 25208577, 27178753, 28186967, 28492141, 28624785, 28953264, 29024195, 29135089, 29693170, 30228782, 30365116, 30877754, 31831830, 32239671, 32513911, 32588696, 33202899, 33837725, 35137551, 36156852, 37047623, 37083591, 37533102, 38167930	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16920701	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35094080	Stimulate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26177500, 28418903, 30975094		★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	34827680	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29027377	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36444838	Inhibit	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	14578863		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30583016, 31534047		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30390010		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33029194	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29361535		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27666924	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	30981841		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19656390, 19823058, 21058027, 24039841, 27497669	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25973072	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24755674, 31290719		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	9023046		★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	30333254	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29285246		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16805824	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	19020730		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29285246		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12838315, 19857493, 30880778, 31054987, 35428295, 35962191, 38043670, 38280862	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23536552		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	27572115		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17397984		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	36060520	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	14724156, 29206199, 30149002	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30149002		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	32321919	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	12811834		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10400703, 16251422, 23387972, 23387973, 23601662, 24599080, 27293031, 29439667, 34702773, 40564997	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	12169389, 15557280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	12811834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	23387973, 26377974, 27125297, 31360198, 31556442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	12811834		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23387973, 26377974, 27125297, 31360198, 31556442		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12054581, 12651906		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15967096, 21373966, 21590492, 21855630, 24879377, 24893038, 25833462, 27693218, 28498494		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24879377, 25833462, 28422726, 28990104, 37270527, 37845206	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIA	Glycogen storage disease	Pubtator	33107920	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	26119934	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34867951	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27036135		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27036135, 37819945	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15133472	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29484384, 30367502		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	29484384	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18941742	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19568240	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	37137886	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	12531888	Associate	★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	19945766		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23545606, 35338412	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25889845	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20109444	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21707509, 29046395, 29144435, 30763282		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29144435	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38053045	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	23784380, 27009091		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30370584	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18987997	Stimulate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17507466		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17514628		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27373675		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	23354874		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	16202218	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26004127	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26785729, 34862757, 37038247	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28280091		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	23354874		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	29132397		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	29190494	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14578863, 15532706, 20305651, 23545258, 24516351, 26443539, 27465549, 28475688, 29210177, 29746931, 30142544, 30292831, 30704479, 30739444, 30849480, 31069844, 31516757, 31522588, 31698037		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14578863		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15102689, 16007195, 19082453		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29786754, 30326962	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15532706, 23545258		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24912675, 35127170	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21707509		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15736429, 19568240, 22178655, 25122425, 27041993, 28068967, 28350337, 28351346, 28991240, 30925742, 36209201, 37445817	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16842883		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17469136	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17469136		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12174366, 12838315, 29665129, 36436682	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33107920	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7692878		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27036135		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	28533307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16136050, 16288304, 17849451, 21071137, 22824793, 23894398, 24885534, 29630900, 29684708, 29796177, 30055645, 31060777, 31080076, 31480645, 31671408, 31706682, 31760124		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29285246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	27373675, 29654156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22272086, 25940797		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28068967, 28351346, 28759022, 28991240, 29048635, 31706682, 31791326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	25199511		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19395869, 23275034, 25724667, 28990249, 29743815, 29890142, 31478830		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22421440, 26191169, 31706682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18449907, 19536794, 21042764, 22378065, 23982184, 24114522, 24223781, 25868388, 28704809, 29088803, 30066854		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19625348, 20869748, 25096402, 28231797		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26786295, 30614803, 30808674		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12531431, 18000363, 18283648, 18990162, 19015641, 19089993, 19462975, 21463917, 21707507, 21707508, 21707509, 24755674, 25833835, 26711783, 27036135, 28036386, 28103122, 28362576, 28533307, 29040002, 29048635, 29228673, 29484384, 29602637, 30218452, 30849480, 30981841, 31069844, 31290719, 31519958, 31732654		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10523844, 25857463, 26648422, 27644693		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12216109, 12847914, 16136050, 16412380, 17515959, 18832579, 19029090		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21071137, 24885534, 27495308		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28533307		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16179862, 25486195, 25873177, 26033450, 29959360		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16552181, 16798740, 18823558, 18941742, 21360640, 22568947, 22810307, 24911159, 27855389, 28560386, 30042328, 30104528, 31140988, 35022419, 35525274, 7543052, 7615962	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18078823		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35525274	Inhibit	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28610844		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28610844, 36288512	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	27736841		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	27736841	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31671889, 34638565, 35794237	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36039594, 37236195	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	25199511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	32183030, 33860659	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	22149168, 31350562		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26282073, 26848618, 31350562, 31532704, 31948430	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24212846		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23047954	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31599782		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24214394, 29927011, 30668347		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24214394, 26339346, 27170279, 33797657, 35836107	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25611393	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11069767, 14578863, 15133472, 16457699, 16740747, 17549350, 17849451, 17999388, 18283648, 19015641, 19395869, 20682712, 21071137, 21247411, 21976712, 22952421, 23255596, 23438844, 23588386, 24121667, 24755674, 24888584, 25079333, 25486195, 25623532, 26377974, 26728244, 27121319, 27260469, 27465549, 27495308, 27793840, 27893716, 28109944, 28231797, 28239470, 28533307, 29048635, 29190494, 29245973, 29625612, 29959360, 29971628, 30055645, 30981841, 31478830, 31841591, 7692878		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	25217104		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17327229, 20515733, 29040002, 31519958		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17327229, 17828307, 19885861, 25862488, 27009842, 35272839	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31690171		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28280091		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30668347		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	GWASDB_DG	22197933		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17549350, 27764812, 27822706, 28576633, 28667800, 28842255, 29088849, 31791326		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17963503, 30583016	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11346466, 24391455, 25550780, 26130413, 28846700, 31122179, 33969873, 34884541	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12376862		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15781325, 24391455, 25339127, 26130413, 26393679, 27812189, 29100277, 29909077, 31122179, 31263675, 31376525		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26393679	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19395869		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15161045, 18353772, 18632638		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19395869, 23275034, 25724667, 28990249, 29743815, 29890142, 31478830		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15161045, 16361572, 18353772, 18632638, 21643014, 23275034, 23545606, 25277212, 25886093, 26497667, 28859612, 28990249, 29700289, 30523211, 34654724, 35027024, 35761259, 36632222, 37875515	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15466376, 24523919	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22421440, 26191169, 31706682		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16209712, 20021699, 21464589, 22889981, 23920124, 25170871, 25268648, 26191169, 29777904, 31059194, 32272917, 32705304, 33025708, 33625109, 35628269, 36516693, 39210440	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38521069	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	33198821	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	15132756	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	37175429	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28423567		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28423567		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30390010		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	19604240		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18449907, 19536794, 21042764, 22378065, 23982184, 24114522, 24223781, 25868388, 28704809, 29088803, 30066854		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	18990162		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11713275, 18922979, 20412587, 20537156, 20725143, 22378065, 24223781, 25277191, 26312765, 26799186, 28704809, 29024195, 29740048, 31929761, 32175798, 32205868, 35682554	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16912186, 18449907, 18922979		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25501808, 30763282		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22814579, 26177500, 28418903		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29597831		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	25611393	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35671035	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	22461510	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29190494, 8105266		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23681745	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	20802517, 21800286	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30352800	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10523844, 25623532, 29897729		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15331608, 17879163		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21401805, 25199511		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12838315, 25963289, 30532074, 30880778		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18349846, 20579373, 24565984, 26752742, 27036135, 28427180, 29970910, 31379147, 33634070, 33860659, 34031486, 34930321, 37819945	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23906871, 28881794		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16740747, 18851943, 25125259, 27036135		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19625348, 20869748, 25096402, 28231797		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	30773850	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	19625348		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20724588, 22160140, 25741138, 26303970, 27278554, 28460635, 32951272, 32964029, 33299895, 33639150, 35471457, 35488236, 36060520, 36193075, 37256823, 37707957, 37950040	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31461955		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	30510582		★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	9351872	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	19572074, 35955827	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15483349, 29665129, 37443754	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	20405349	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15657578, 17397984		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26392228		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15483349, 29665129	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25277206	Stimulate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	29970910, 31023264, 32236620, 33634070	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24693876	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25304315, 25749031, 27484639, 30237308, 30728047, 31926619, 32325700, 33006750, 35429924, 37185776, 37254289, 39769120	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27793840, 30728047		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	24606538	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22353809, 26786295, 26837847, 31648990, 36436682, 37932474, 40654029	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	25833835		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14675348, 24058594, 32416888, 32604782, 35104170, 36088372, 36838908	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21058027	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36596361	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34619327	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	15750208	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	19494199	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	LHGDN	12135674		★☆☆☆☆ Found in Text Mining only