Gene Gene information from NCBI Gene database.
Entrez ID 5744
Gene name Parathyroid hormone like hormone
Gene symbol PTHLH
Synonyms (NCBI Gene)
BDE2HHMPLPPTHRPTHRP
Chromosome 12
Chromosome location 12p11.22
Summary The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs267606985 A>G Pathogenic Missense variant, coding sequence variant
rs267606986 A>G Pathogenic Missense variant, coding sequence variant
rs267606987 T>C Pathogenic Genic downstream transcript variant, stop lost, terminator codon variant
rs267606988 T>A Pathogenic Stop gained, coding sequence variant
rs1555124505 A>G Likely-pathogenic Stop lost, terminator codon variant, splice donor variant
miRNA miRNA information provided by mirtarbase database.
40
miRTarBase ID miRNA Experiments Reference
MIRT035547 hsa-miR-33a-5p Luciferase reporter assay 23453925
MIRT035547 hsa-miR-33a-5p Luciferase reporter assay 23453925
MIRT735610 hsa-miR-370-3p RNA-seqqRT-PCR 32065449
MIRT1273385 hsa-miR-3942-3p CLIP-seq
MIRT1273386 hsa-miR-4729 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Transcription factor Regulation Reference
ETS1 Activation 15072578;8063775
ETS1 Unknown 11590145
NFKB1 Activation 17554373
RELA Activation 17554373
SMAD3 Activation 24330518
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IDA 9008714
GO:0002076 Process Osteoblast development IBA
GO:0005179 Function Hormone activity IBA
GO:0005179 Function Hormone activity IDA 19674967, 35932760
GO:0005179 Function Hormone activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
168470 9607 ENSG00000087494
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P12272
Protein name Parathyroid hormone-related protein (PTH-rP) (PTHrP) (Parathyroid hormone-like protein) (PLP) [Cleaved into: PTHrP[1-36]; PTHrP[38-94]; Osteostatin (PTHrP[107-139])]
Protein function Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport (PubMed:12538599, PubMed:35932760, PubMed:3616618). Acts by binding t
PDB 1BZG , 1M5N , 3FFD , 3H3G , 7UZO , 7UZP , 7VVJ , 8D51 , 8D52 , 8FLR , 8HAF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01279 Parathyroid 34 128 Parathyroid hormone family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Also expressed in the mammary gland.
Sequence
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKG
KPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Sequence length 177
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hormone signaling
Parathyroid hormone synthesis, secretion and action
  Class B/2 (Secretin family receptors)
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
51
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Brachydactyly type E2 Pathogenic rs2120670890, rs267606985, rs267606986, rs267606987, rs267606988 RCV001553657
RCV000014745
RCV000014746
RCV000014747
RCV000014748
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BONE RESORPTION CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Achondroplasia Achondroplasia Pubtator 12929929 Inhibit
★☆☆☆☆
Found in Text Mining only
Achondroplasia Achondroplasia BEFREE 22634226
★☆☆☆☆
Found in Text Mining only
Acro-Osteolysis Acrosteolysis BEFREE 26733284
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 22280800, 25035110
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 8277370, 8314318
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 17964713
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 19633068, 20890111
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 11893937
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 12230264, 8685051
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 11813867, 2066698
★☆☆☆☆
Found in Text Mining only