PTGS2 (prostaglandin-endoperoxide synthase 2)

Gene

• Entrez ID: 5743
• Gene name: Prostaglandin-endoperoxide synthase 2
• Gene symbol: PTGS2
• Synonyms (NCBI Gene): COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
• Chromosome: 1
• Chromosome location: 1q31.1
• Summary: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004297	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133256
MIRT004297	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	19133256
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	20100477
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	20100477
MIRT004297	hsa-miR-101-3p	qRT-PCR	20712078
MIRT001603	hsa-let-7b-5p	pSILAC	18668040
MIRT001426	hsa-miR-16-5p	pSILAC	18668040
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006329	hsa-miR-137	Luciferase reporter assay, Western blot	22406049
MIRT006757	hsa-miR-143-3p	Luciferase reporter assay	21790228
MIRT004297	hsa-miR-101-3p	qRT-PCR, Western blot	23013439
MIRT001426	hsa-miR-16-5p	Luciferase reporter assay	23226427
MIRT001426	hsa-miR-16-5p	Luciferase reporter assay	23226427
MIRT017755	hsa-miR-335-5p	Microarray	18185580
MIRT021768	hsa-miR-132-3p	Microarray	17612493
MIRT021956	hsa-miR-128-3p	Microarray	17612493
MIRT022542	hsa-miR-124-3p	Microarray	18668037
MIRT025094	hsa-miR-181a-5p	Microarray	17612493
MIRT004659	hsa-miR-26b-5p	Reporter assay	20100477
MIRT001426	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT001603	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT052956	hsa-miR-199a-3p	Luciferase reporter assay, Western blot	22294637
MIRT052956	hsa-miR-199a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22294637
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23374284
MIRT054370	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	24413338
MIRT437360	hsa-miR-589-5p	5RACE, Next Generation Sequencing (NGS), qRT-PCR, Western blot	23999091
MIRT437360	hsa-miR-589-5p	5RACE, Next Generation Sequencing (NGS), qRT-PCR, Western blot	23999091
MIRT006757	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	24105952
MIRT437813	hsa-miR-558	Luciferase reporter assay	23611898
MIRT439871	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT439871	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26959737
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26959737
MIRT732183	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959737
MIRT732183	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	26959737
MIRT004297	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556718
MIRT004297	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556718
MIRT004659	hsa-miR-26b-5p	Luciferase reporter assay, Western blot	27769043
MIRT004297	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26530100
MIRT004297	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26530100
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27900011
MIRT052956	hsa-miR-199a-3p	qRT-PCR	33707464
MIRT732182	hsa-miR-26a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35783137
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT1273361	hsa-miR-1303	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT1273366	hsa-miR-4659a-3p	CLIP-seq
MIRT1273367	hsa-miR-4659b-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT1273370	hsa-miR-4778-3p	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT1273374	hsa-miR-595	CLIP-seq
MIRT1273375	hsa-miR-659	CLIP-seq
MIRT2080413	hsa-miR-103b	CLIP-seq
MIRT2080414	hsa-miR-1279	CLIP-seq
MIRT2080415	hsa-miR-300	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2080417	hsa-miR-340	CLIP-seq
MIRT2080418	hsa-miR-381	CLIP-seq
MIRT2080419	hsa-miR-4666-3p	CLIP-seq
MIRT2080420	hsa-miR-4789-5p	CLIP-seq
MIRT2080421	hsa-miR-548p	CLIP-seq
MIRT2306583	hsa-miR-4272	CLIP-seq
MIRT2306584	hsa-miR-4645-3p	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT2439690	hsa-miR-2053	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT2439699	hsa-miR-569	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2457410	hsa-miR-219-2-3p	CLIP-seq
MIRT2457411	hsa-miR-2964a-3p	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT2457412	hsa-miR-4680-3p	CLIP-seq
MIRT2457413	hsa-miR-4724-5p	CLIP-seq
MIRT2457414	hsa-miR-501-3p	CLIP-seq
MIRT2457415	hsa-miR-502-3p	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2465931	hsa-miR-4517	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2604244	hsa-miR-1269	CLIP-seq
MIRT2604245	hsa-miR-1269b	CLIP-seq
MIRT2604246	hsa-miR-1288	CLIP-seq
MIRT2604247	hsa-miR-1323	CLIP-seq
MIRT2604248	hsa-miR-181a	CLIP-seq
MIRT2604249	hsa-miR-181b	CLIP-seq
MIRT2604250	hsa-miR-181c	CLIP-seq
MIRT2604251	hsa-miR-181d	CLIP-seq
MIRT2604252	hsa-miR-183	CLIP-seq
MIRT2604253	hsa-miR-190	CLIP-seq
MIRT2604254	hsa-miR-190b	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT2604255	hsa-miR-203	CLIP-seq
MIRT2439690	hsa-miR-2053	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2604256	hsa-miR-3173-3p	CLIP-seq
MIRT2604257	hsa-miR-3182	CLIP-seq
MIRT2604258	hsa-miR-338-5p	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2604259	hsa-miR-3646	CLIP-seq
MIRT2604260	hsa-miR-3689a-5p	CLIP-seq
MIRT2604261	hsa-miR-3689b	CLIP-seq
MIRT2604262	hsa-miR-3689e	CLIP-seq
MIRT2604263	hsa-miR-3689f	CLIP-seq
MIRT2604264	hsa-miR-371b-5p	CLIP-seq
MIRT2604265	hsa-miR-3974	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT2604266	hsa-miR-4262	CLIP-seq
MIRT2604267	hsa-miR-4265	CLIP-seq
MIRT2306583	hsa-miR-4272	CLIP-seq
MIRT2604268	hsa-miR-4282	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2604269	hsa-miR-4296	CLIP-seq
MIRT2604270	hsa-miR-4317	CLIP-seq
MIRT2604271	hsa-miR-4322	CLIP-seq
MIRT2604272	hsa-miR-4417	CLIP-seq
MIRT2604273	hsa-miR-4428	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT2604274	hsa-miR-4474-3p	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT2604275	hsa-miR-450b-5p	CLIP-seq
MIRT2604276	hsa-miR-4515	CLIP-seq
MIRT2604277	hsa-miR-4652-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT2604278	hsa-miR-4714-3p	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2604279	hsa-miR-4740-5p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2604280	hsa-miR-4803	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT2604281	hsa-miR-495	CLIP-seq
MIRT2604282	hsa-miR-507	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT2604283	hsa-miR-513c	CLIP-seq
MIRT2604284	hsa-miR-514b-5p	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT2604285	hsa-miR-548o	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2604286	hsa-miR-557	CLIP-seq
MIRT2439699	hsa-miR-569	CLIP-seq
MIRT2604287	hsa-miR-577	CLIP-seq
MIRT2604288	hsa-miR-616	CLIP-seq
MIRT2604289	hsa-miR-617	CLIP-seq
MIRT2604290	hsa-miR-622	CLIP-seq
MIRT2604291	hsa-miR-642b	CLIP-seq
MIRT2604292	hsa-miR-656	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2604293	hsa-miR-802	CLIP-seq
MIRT2604294	hsa-miR-889	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq
MIRT1273360	hsa-miR-1264	CLIP-seq
MIRT2439689	hsa-miR-1915	CLIP-seq
MIRT1273362	hsa-miR-202	CLIP-seq
MIRT2604255	hsa-miR-203	CLIP-seq
MIRT2439691	hsa-miR-214	CLIP-seq
MIRT2080416	hsa-miR-3163	CLIP-seq
MIRT2604257	hsa-miR-3182	CLIP-seq
MIRT2439692	hsa-miR-3619-5p	CLIP-seq
MIRT2604259	hsa-miR-3646	CLIP-seq
MIRT1273363	hsa-miR-412	CLIP-seq
MIRT2604268	hsa-miR-4282	CLIP-seq
MIRT2439693	hsa-miR-4291	CLIP-seq
MIRT2604270	hsa-miR-4317	CLIP-seq
MIRT1273364	hsa-miR-4457	CLIP-seq
MIRT1273365	hsa-miR-4503	CLIP-seq
MIRT2604277	hsa-miR-4652-3p	CLIP-seq
MIRT1273368	hsa-miR-4678	CLIP-seq
MIRT1273369	hsa-miR-4709-3p	CLIP-seq
MIRT2439694	hsa-miR-4726-3p	CLIP-seq
MIRT2439695	hsa-miR-4731-3p	CLIP-seq
MIRT2439696	hsa-miR-4801	CLIP-seq
MIRT2604280	hsa-miR-4803	CLIP-seq
MIRT2439697	hsa-miR-494	CLIP-seq
MIRT1273371	hsa-miR-513b	CLIP-seq
MIRT2439698	hsa-miR-543	CLIP-seq
MIRT1273372	hsa-miR-548n	CLIP-seq
MIRT1273373	hsa-miR-548t	CLIP-seq
MIRT2604287	hsa-miR-577	CLIP-seq
MIRT2604288	hsa-miR-616	CLIP-seq
MIRT2604289	hsa-miR-617	CLIP-seq
MIRT2439700	hsa-miR-761	CLIP-seq
MIRT2604293	hsa-miR-802	CLIP-seq
MIRT2439701	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APC	Repression	10772828;12566320
APC	Unknown	11396184
AR	Repression	18386814
ATF2	Unknown	11278336;12057991
ATF4	Unknown	21244365
CDX1	Activation	21613300
CDX2	Repression	15013430
CEBPB	Activation	16820889;18294142
CEBPB	Repression	18820298
CEBPB	Unknown	10956548;16699180;17556653;7559624
CEBPD	Unknown	7559624
CREB1	Activation	22919060
CREBBP	Unknown	11278336
CTNNB1	Unknown	11396184
DR1	Activation	11840453
EGR1	Repression	15517885
EGR2	Unknown	24007274
ELF3	Unknown	15794755
ENO1	Unknown	19846662
EP300	Activation	12471036
EP300	Unknown	12057991;17237818;17395887
ETV4	Activation	11274170
FOS	Activation	9620167
FOS	Unknown	11278336;12057991;17556653
HDAC1	Activation	17395887
HDAC4	Activation	18820298
HMGA1	Activation	22898640
ING4	Repression	18399550
JUN	Activation	15772294;18294142;9620167
JUN	Unknown	11278336;12057991;16339564;17556653;20237399
JUNB	Activation	9620167
JUND	Activation	9620167
NFIL3	Unknown	1620116
NFKB1	Activation	10827178;12471036;15368354;15387324;15547942;15555528;15997464;16624933;16820889;18057724;18294142;19618291;22001128
NFKB1	Repression	12622742;15517885
NFKB1	Unknown	12067569;12349897;12871860;14988266;15655349;16210649;17556653;17673602;17767925;18973191;19766095;20103608;20669087
NR0B2	Activation	21613300
PGR	Repression	18483177
PPARA	Activation	11412039
PPARG	Activation	11412039
PPARG	Repression	14555539;16506021
PPARG	Unknown	10827178;11278336
RELA	Activation	10827178;12471036;15368354;15387324;15547942;15555528;15997464;16624933;16820889;18057724;18294142;19618291;22001128
RELA	Repression	12622742;15517885
RELA	Unknown	12067569;12349897;12871860;14645117;14988266;15655349;16210649;17556653;17673602;17767925;18973191;19766095;20103608;20669087
SETBP1	Repression	18419541
SP1	Activation	15767339
SP1	Repression	15767339
STAT1	Activation	12586443
STAT1	Unknown	10433370;16685393
STAT2	Activation	12586443
STAT3	Activation	20145033
STAT3	Unknown	21172343
STAT6	Activation	17237818
TCF7L2	Unknown	11396184
TFAP2A	Unknown	16423197
USF1	Repression	18817855
USF2	Unknown	12057991

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	27642067
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0001516	Process	Prostaglandin biosynthetic process	NAS	20448152
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	NAS	14511332
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IBA
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IDA	1380156, 7592599, 7947975, 16373578
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IEA
GO:0005515	Function	Protein binding	IPI	24089527, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005637	Component	Nuclear inner membrane	IDA	9545330
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005640	Component	Nuclear outer membrane	IDA	9545330
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14511332
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	24089527
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS	24089527
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0009624	Process	Response to nematode	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	ISS	9630216
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	EXP	12391014
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	TAS
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA
GO:0019371	Process	Cyclooxygenase pathway	IBA
GO:0019371	Process	Cyclooxygenase pathway	IDA	1380156, 7592599, 7947975
GO:0019371	Process	Cyclooxygenase pathway	IEA
GO:0019371	Process	Cyclooxygenase pathway	IEA
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0019899	Function	Enzyme binding	IPI	16373578
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	NAS	20448152
GO:0031622	Process	Positive regulation of fever generation	IEA
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0032310	Process	Prostaglandin secretion	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IDA	12355421
GO:0043005	Component	Neuron projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS	9630216
GO:0046697	Process	Decidualization	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050727	Process	Regulation of inflammatory response	NAS	14511332
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0071456	Process	Cellular response to hypoxia	IEP	21296955
GO:0071471	Process	Cellular response to non-ionic osmotic stress	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0071636	Process	Positive regulation of transforming growth factor beta production	ISS	9630216
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	ISS	9630216
GO:0090271	Process	Positive regulation of fibroblast growth factor production	ISS	9630216
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS	20448152
GO:0090362	Process	Positive regulation of platelet-derived growth factor production	ISS
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1902219	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IEA

Other IDs

• MIM: 600262
• HGNC: 9605
• e!Ensembl: ENSG00000073756

Protein

• UniProt ID: P35354
• Protein name: Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase-2) (COX-2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (Prostaglandin-endoperoxide synthase 2)
• Protein function: Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20:4(n-6)), with a particular role in the inflammatory response (Pu
• PDB: 5F19, 5F1A, 5IKQ, 5IKR, 5IKT, 5IKV, 5KIR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00008	EGF	21 → 53	EGF-like domain	Domain
  PF03098	An_peroxidase	201 → 560	Animal haem peroxidase	Domain

• Sequence:

  MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
  TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
  GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
  NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
  QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
  VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
  NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
  AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
  YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
  GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
  STEL

• Sequence length: 604

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
Efferocytosis
VEGF signaling pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Leishmaniasis
Human cytomegalovirus infection
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis - DNA adducts
MicroRNAs in cancer
Small cell lung cancer

Reactome:

Nicotinamide salvaging
Synthesis of 15-eicosatetraenoic acid derivatives
Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Biosynthesis of DHA-derived SPMs
Biosynthesis of EPA-derived SPMs
Biosynthesis of DPAn-3 SPMs
Biosynthesis of electrophilic ω-3 PUFA oxo-derivatives

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMIAS, CARDIAC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT ESOPHAGUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER NECK OBSTRUCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CACHEXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA IN SITU	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL, BREAST	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	other	ClinVar CTD	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDRONEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL POLYPS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERICARDIAL EFFUSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS, ALLERGIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NECK OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	25616959, 28692590		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	10417761, 17488409, 17578436, 30618533		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	20083630		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18989535, 19485927, 19748095		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18989535		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	23435965, 29501042		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	12865795		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28270082		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19820421, 28697127, 29511434		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	15190260		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31349508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10070951, 10353732, 10471521, 10630643, 10657949, 10665651, 10668484, 10815926, 11005569, 11059772, 11223821, 11344234, 11448905, 11494020, 11592775, 11793368, 11920472, 11920515, 12469191, 12596060, 12713622, 12781040, 12893070, 14616542, 15033780, 15231484, 15246187, 15269153, 15475936, 15704107, 15710986, 16081631, 16482563, 16521222, 16550596, 16712734, 16733863, 16786043, 17244951, 18094611, 18230181, 18327873, 18443952, 18648368, 19758455, 19843025, 19925030, 20075740, 20686774, 22287745, 24149137, 24950702, 25169526, 25228975, 29254791, 29324448, 29765153, 31289003, 8566864, 9703885, 9731479, 9823297, 9872498		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11891209, 11920472, 11920515, 12162677, 12532441, 12679908, 12748469, 12855643, 14616542, 14744769, 15921850, 16111807, 16215757, 16521222, 16542464, 16574793, 16681759, 16702519, 17006983, 17581270, 18000398, 18032824, 18230181, 18330937, 18349295		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	11150521, 16319132, 16458424, 16909108		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11005569, 11059772, 12060038, 14641306, 15205347, 15585388, 15623628, 15720819, 15958546, 16521222, 16550596, 16702519, 16712734, 17403674, 17477358, 17581270, 18349295, 20814068, 21971589, 22258871, 24206575, 30408225, 30982333		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	CTD_human_DG	12507933		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	15313405, 15816542, 25169526		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10353732, 10515422, 11585835, 12144868, 14744769, 16542464, 16707460, 17363603, 17632087, 21617857, 22696230, 25465874, 25797267, 26022894, 26191267, 26452035, 26464643, 29025423, 29238224, 29434991, 30121641, 31163629, 9823297		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10070951, 14656949, 16083499, 22898640, 31162144		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11571629, 14532848, 23289871, 30402808, 30972191		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	30003391		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10398082, 10965822, 11129221, 11309440, 11584208, 11687954, 11751493, 11920515, 12873979, 15550453, 15930344, 16103460, 16139560, 16205694, 16540660, 17277229, 17875695, 18094611, 18230181, 19031967, 19246453, 19307727, 19470469, 19755647, 20046424, 20427397, 21158711, 21573497, 22551900, 22580984, 23595116, 23741059, 23975167, 25166592, 28729694, 28948694, 29137605, 29339153, 29769213, 7926468		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	11920515, 15355919, 16110762, 16760271, 17640058, 18167131, 18230181, 18462368, 19031967		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11129221, 11751489, 12873979, 15501074, 15550453, 15695237, 15767339, 15807932, 16205694, 16391811, 16482563, 16775170, 16818642, 17640058, 18094611, 18167131, 18230181, 19031967, 19124115, 19205707, 19755647, 20087348, 20427397, 22082586, 26482433, 28139497, 28729694, 29769213, 30106414, 7926468		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10204802, 10419916, 10545404, 10956391, 11396184, 11685545, 11713587, 11945149, 12102579, 12174906, 14508092, 14585257, 15150127, 15188000, 15285921, 15930344, 16103460, 16391811, 17785554, 18094611, 18844223, 19124115, 19544971, 20593240, 24245549, 26609171, 28940183, 29350052, 30650553, 9327228, 9809998, 9831333		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	15628724		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	16685273, 29763272		★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	CTD_human_DG	15492235		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	CTD_human_DG	15492235		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31142060		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31187468		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26984380		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	17064999, 30349293		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22707305, 28417956		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	14508834		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30367261		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	18173398		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	14962510		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28558302, 30953868		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	11980643		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12050157, 23613363, 24963629, 31861093, 34749366	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22832605	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	18307244		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	28123497, 29559247		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	15513908, 28449688		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	16103460, 16391811, 20593240		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	11220737, 15816863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12362410, 12447931, 15804265, 17300945, 25811799, 27140190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29246232	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	12437573	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	11220737, 15816863		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	11220737, 15816863		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30502795, 31661132		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10485483		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19048457		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31664161		★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	15489961		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	10388637, 27159620	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	31700919		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28403136, 29849019, 9433877		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21847358, 25299780, 28352075, 29565462, 31046874, 31186753, 31588122		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	27375005, 27940259		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31398429, 31778792		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	24899082		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23912944, 29132299		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23912944, 29132299		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	33849116	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	10825178, 22588264	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	30292829		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	CTD_human_DG	16514081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	19625268, 22595380, 29408196, 31328426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30367261		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10942685, 12352013, 15531779, 16458279, 16785826, 17350020, 17363696, 17495879, 18323528, 19046748, 19307727, 20332714, 20974241, 22551325, 23907768, 23957944, 28069582, 28194409, 29216624, 30011214, 30875493		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	10643694, 10708568, 11067848, 11805193, 14506909, 14967078, 18513703, 19184362, 22910222, 25893742, 26505439, 28298526, 28614768, 30011214, 30072617, 30668316, 30671313, 30715482, 30831463, 31666999, 9433877		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	38001449	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	31480263	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10719816, 12794822, 15077295, 15225373, 16427328, 16508938, 17848581, 26505439, 28708839, 30314410, 33707464, 33977746, 36435778, 36439145, 37667923, 38107658, 9041934	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14558087	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28883751, 9433877		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	19330880, 9433877, 9714356		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	CTD_human_DG	17963755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	10390414, 11964666, 12622742, 12754192, 15316498, 15480320, 15482000, 15544595, 16024651, 16825866, 17573729, 17622692, 18489027, 18753249, 18769189, 21703343, 22416915, 25180620, 25217662, 25721048, 26685098, 27188427, 28949387, 29249187, 29967100, 30953868		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17573729, 18489027, 18753249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18583575, 22416915, 23240010, 23441755, 25721048	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	CTD_human_DG	16502481, 20485159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	CTD_human_DG	25721048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10501211, 17627037, 17640750		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10501211, 17640750, 35746681	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	16868662, 17640750		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21294088	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19584262	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30085341	Associate	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	34425224	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10514410, 10942685, 14752026, 16399867, 16894405, 20332714, 22588264, 28194409, 34427537, 36690661, 40708018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	10942685, 12352013, 15531779, 16458279, 16785826, 17350020, 17363696, 17495879, 18323528, 19046748, 19307727, 20332714, 20974241, 22551325, 23907768, 23957944, 28069582, 28194409, 29216624, 30011214, 30875493		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	14642682	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	16186418, 16458279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	20720404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	16479190		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	19522023	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	21683347, 32603043	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18579107, 29161772, 30027581, 30953868		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	18579107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18579107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	30027581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20615394, 22017396, 29756563		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	11939728, 15817909		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	LHGDN	11939728		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	CTD_human_DG	14654083		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	17668203, 19966855, 23393346, 26026079, 26808646, 27601129, 28450936, 29050265, 29207118, 29484409, 29484431, 29568888, 30255981, 30844427, 30986204, 31113339, 31222746, 31772707		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	11005569, 20814068		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	CTD_human_DG	11059772, 15387324, 17244951		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11059772, 12713622, 14641306, 15231484, 15269153, 15585388, 16521222, 16550596, 16863546, 17222248, 19843025, 20653782, 20814068, 21325951, 21969813, 22147251, 23955118, 24357184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	CTD_human_DG	11059772, 15387324, 17244951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	12121879, 14631367, 14633942, 15231484, 16521222, 16682957, 17403674, 18400718, 21969813, 22667343	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	LHGDN	15231484, 16521222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	17615180	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bartter Disease	Bartter syndrome	BEFREE	30426218		★☆☆☆☆ Found in Text Mining only
Bartter Syndrome	Bartter syndrome	Pubtator	11115075	Associate	★☆☆☆☆ Found in Text Mining only
Bartter syndrome antenatal type 1	Bartter syndrome	Pubtator	12081585	Associate	★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	17307204, 17578436		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	20155627		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	27498419		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10931458, 11913955, 15287094, 17764114, 17911400, 18004747, 18242387, 26920155, 28391389, 30178825, 30972191, 31029761		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	28972958	Stimulate	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	11584358, 16361272, 16755536, 20740367		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile Duct Neoplasms	BEFREE	11584358		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	15161010, 24950702, 26423666	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile Duct Neoplasms	LHGDN	16361272		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	16361272		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	19201881	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	22760556	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26609651, 29102659		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	CTD_human_DG	15311063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	10582676, 10873095, 12442003, 12664575, 16098373, 17093206, 29396848		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10880372, 11342898, 11694654, 11827414, 12352459, 12442003, 15240520, 15596291, 16596191, 18367112, 18617357, 20582552, 20627335, 22288910, 23705854, 24324075, 25109742, 25196524, 30482227, 31198976, 31443756, 31497247, 31775672		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16010419, 18381966		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	11772972	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	18663571	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	21933591		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	CTD_human_DG	16489006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bowen's Disease		Pubtator	22667343	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15737438, 17394460, 17564305, 19417757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	11563634, 23250387		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	16319525, 16900783	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24792472, 25142612		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10402236, 11501838, 11897504, 11912139, 12063562, 12359744, 12455057, 12472107, 12736714, 12740157, 12825860, 12902864, 12907138, 14499627, 14648704, 14993030, 15033780, 15328200, 15642177, 15741054, 15753376, 15809733, 15833882, 15856465, 15923426, 15967164, 16030101, 16213894, 16243823, 16287071, 16353170, 16391819, 16480277, 16489098, 16498361, 16502408, 16507389, 16507397, 16650963, 16712450, 16870006, 16885386, 16888001, 17156488, 17181859, 17214885, 17332916, 17352244, 17418864, 17479405, 17510310, 17542993, 17580278, 17612393, 17624587, 17657731, 18001219, 18045954, 18090122, 18192694, 18199541, 18202791, 18386173, 18663571, 18953425, 19138835, 19190350, 19241157, 19244345, 19276290, 19390242, 19428334, 19576865, 19940361, 19965896, 20033767, 20093341, 20211985, 20229271, 20536410, 20608938, 20631072, 20676755, 20711808, 20878073, 21047437, 21059239, 21071999, 21078168, 21153458, 21310944, 21409596, 21476934, 21533532, 21655952, 21683430, 21796157, 21907301, 21971413, 22037828, 22213327, 22242594, 22286316, 22333315, 22938493, 23029485, 23098208, 23275522, 23566419, 23792017, 24325753, 24402873, 24434582, 24535190, 24590894, 24789723, 24859472, 24923427, 24927687, 24950714, 25060643, 25214704, 25242400, 25323004, 25368279, 25374215, 25433948, 25476497, 25511800, 25520090, 25520137, 25667510, 25733698, 25754990, 25773924, 26227474, 26359357, 26416248, 27301070, 27323060, 27632554, 27779707, 27821648, 27835884, 27994517, 27999206, 28029661, 28054666, 28056899, 28152501, 28240006, 28393249, 28486908, 28490464, 28571770, 28605338, 28618256, 28663087, 28666869, 28709031, 28808873, 28906164, 28927045, 28964785, 29202630, 29250535, 29321183, 29321644, 29501042, 29550515, 29587668, 29658109, 29661238, 29928417, 30051683, 30314513, 30338705, 30339576, 30539699, 30702971, 30747082, 30769266, 30970220, 30999962, 31185986, 31195426, 31203442, 31289003, 31300611, 31349508, 31494294, 31506784, 31524251, 31534346, 31623608, 31638237, 31759380, 31783895, 9521170		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16127422, 16870006, 17285134, 18498876, 18509974		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10571077, 11901151, 12037025, 12767095, 12784332, 12884024, 15330183, 15753376, 16127422, 16168133, 16421596, 16424122, 16457694, 16497869, 16505480, 16831226, 17181859, 17192687, 17214885, 17612393, 18190720, 18248671, 18319253, 18381931, 18386173, 18663571, 19056653, 19282568, 19890662, 19940361, 19965896, 20211985, 20229271, 20462604, 20503412, 20608938, 20676755, 20691996, 20711808, 21047437, 21059239, 21085606, 21153458, 21310944, 21355070, 21728052, 21792195, 21857970, 21953546, 22333315, 22353218, 23275522, 23566419, 24065467, 24325753, 24434582, 24789723, 24950714, 24965402, 25242400, 25256221, 25269624, 25287138, 25374215, 25476497, 25511800, 25520137, 28054666, 28618256, 28808873, 29429545, 29587668, 30702971, 31203442, 31289003, 31638237, 31759380, 32238697, 32988253, 33801351, 35436939, 35743318, 36757813, 37540709, 37643511	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19244345	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19667157, 23771849	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23470621, 29952221		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	23567332		★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	15726092, 16779827		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	20594217, 25339021		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	24443892	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10920275, 11150521, 11733561, 12046075, 12164941, 12480928, 12698187, 12970891, 14675489, 15055524, 15234907, 15285012, 15334675, 15713675, 15816645, 16085694, 16097073, 16158946, 16334139, 16371352, 16521222, 16685273, 16819278, 17515883, 17962194, 18094611, 18190720, 18230181, 18381589, 18758643, 19056653, 19088039, 19108014, 19201881, 19208339, 19300368, 19318492, 19465063, 20122271, 20200425, 20209608, 20237896, 20346139, 20348947, 20592893, 20864903, 21103921, 21294088, 21488197, 21572400, 22039326, 22843946, 23317244, 24056964, 24516579, 24694755, 24983372, 24989014, 25064845, 25166592, 25169526, 25579548, 25743830, 26222488, 26881519, 27072264, 27314294, 29306248, 30106414, 30488858, 31187468, 33327467, 33440718, 34888378, 35163465, 36430918, 8643486, 9786845	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15753376, 15858127, 19124115, 30580362	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10398082, 10471521, 10485483, 10880372, 11196178, 11238189, 11346869, 11788675, 11793368, 11827414, 11920595, 11948128, 12468638, 12684668, 12738747, 12740157, 12747975, 12900768, 12912958, 14550281, 14623934, 15266333, 15501972, 15622477, 15622585, 15642177, 15681840, 15753378, 15817909, 15947945, 15958546, 16103460, 16205694, 16319525, 16362262, 16458424, 16774944, 17177652, 17265445, 18094611, 18230181, 18592138, 19102009, 19108014, 20025478, 20846124, 23261444, 23975167, 25228975, 25278683, 26957558, 27854106, 30496799, 30826660, 7926468, 9809985, 9823297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	10485483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	16080510, 17767717, 20234320, 21412163	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	15610530, 18843292, 24518705, 30845292, 31334675	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	22667343	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	24950714	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35743985	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21153458	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11854904, 12046075, 12378621, 15055524, 15298730, 15800977, 16014934, 16094702, 16273635, 16419156, 17451196, 17964630, 18092051, 20652159, 21057160, 21692943, 23391762, 23776502, 26554780, 26881519, 27092498, 27818595, 27982164, 28246472, 29295728, 29962817, 31059053, 34571852, 35637248, 35979755, 40139029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15156159	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23091809	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12750248, 16421596, 20427430	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	15753376, 23216814	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	35743985	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	15897577		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10880372, 11342898, 11694654, 11827414, 12197220, 12352459, 12442003, 15240520, 15596291, 16596191, 18367112, 18617357, 20582552, 20627335, 22288910, 22634839, 23705854, 24324075, 25109742, 25196524, 30482227, 31198976, 31443756, 31497247, 31775672		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12782823, 19280666, 28739688		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10353732, 11208460, 11320076, 11464289, 11494020, 11882767, 11920472, 12686753, 12708493, 14967078, 15221958, 15765920, 15777967, 15825163, 15829319, 15882925, 16170027, 16376453, 16397226, 16542464, 16786043, 16912160, 17214885, 17342322, 17342342, 18164040, 19217709, 19409031, 19755515, 19918789, 20530427, 20645029, 21150337, 21198273, 21461558, 21678473, 22160576, 22292629, 22464751, 22696230, 22761909, 23065687, 23943857, 24098479, 24337484, 24344016, 24909729, 25004182, 25047043, 25113252, 25137041, 25175164, 25465874, 25797267, 25817787, 26430963, 26452035, 26600514, 26624903, 26744864, 26774881, 26863638, 27450326, 28150906, 28173828, 28282799, 28709031, 29025423, 29113232, 29345286, 29408308, 29610553, 30114468, 30131302, 30170377, 30365050, 30591531, 31186812, 31231223, 31347609, 7706493, 9515807, 9823297		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16681724	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	16467169, 26675757, 27057636, 31046874, 35184402, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28222855	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15744816, 16369983, 17284111, 21161467, 25488950, 26925639, 28004769, 29559845, 30580362	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	16014119, 30414472	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10506169, 11953864, 12209745, 12445196, 12875991, 15173710, 17291249, 19203995, 19596931, 20192574, 21572400, 22038215, 22534023, 25392182, 26960457, 29512696, 34320931	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14976535, 16055866, 22667343	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	11238034	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	20423998, 21790228, 24083698	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10417761, 15610530, 16185283, 16528365, 16596229, 17307204, 17578436, 20051366, 22159575, 28230039, 29775390, 30083255, 30845292, 31334675		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	10485483, 16820089		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11489832, 12469191, 12615701, 14633672, 14647459, 14719060, 14729623, 15269139, 15781636, 15963707, 16044148, 17309668, 17667594, 18090132, 18306389, 18362203, 18798061, 19621391, 20559705, 21107726, 21756326, 23978451, 24718658, 25335121, 28599493, 29152148, 29324448, 29727350, 29932878, 30647111, 31817839, 31822119		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10485483		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	19900134, 26222488	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	17198778	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	11978490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	11978490		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24950714, 28695302		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15061569, 15681294, 16458279, 16879213, 17495879, 18768181, 19327107, 21114363, 24796340, 25888188, 28699682, 28863826, 29309904, 30156911, 30325206, 30875493, 31779538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17495879		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17495879, 18768181, 19638987, 21114363, 24796340, 36035865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	17518513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	16212965		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	26195278, 28704403	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	28666239		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	22922684, 30761249		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	25626972		★☆☆☆☆ Found in Text Mining only
Cecal Neoplasms	Cecal neoplasms	Pubtator	20864903	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	25134430		★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	21426319, 25922506		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10584847, 23609497, 23765972		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	16529823, 28704403, 31183363, 35856366, 40681605	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26781425		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15138244, 17350020, 17495879, 20472470, 21236709, 22015313, 22759265, 22763923, 23907768, 25957909, 26543101, 28275651, 28300652, 28478978, 28912645, 29399074, 30396759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	15138244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	20083630		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	16479190, 19033684, 25957909		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	28194409	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11156216, 11234900, 11844819, 17404026, 17440114, 17578348, 20686383, 22729746, 24289600, 24528073, 26881213, 28881683, 31614548		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	15790444, 18565574, 23268324, 28599442, 29431861		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11156216, 11234900, 11344234, 11844819, 15790444, 17404026, 17440114, 17578348, 20686383, 22729746, 24289600, 24528073, 26881213, 28881683, 31614548		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20944149, 25172542		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	26984380		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22707305, 28417956		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	14508834		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11870367, 11910351, 12654561, 12717864, 16361272, 16755536, 16966336, 18199552, 19218340, 20740367, 23608225, 24699315, 26125824, 26718397, 28728977, 29725387, 29872269, 30753687		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	12143054, 12800245, 14607721, 19218340		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12800245, 15855163, 16790433, 16966336, 17165088, 19218340, 26125824, 26276523	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	16818635		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18507031	Stimulate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholecystolithiasis	Cholecystolithiasis	BEFREE	16361272, 19455278		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	16361272, 19455278		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	23832258		★☆☆☆☆ Found in Text Mining only
Chondroblastoma	Chondroblastoma	LHGDN	13680221		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	20178602, 21874258, 23523690		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	23683582		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	15234907	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	22828789	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26543101, 29982796		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26543101, 31841390		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	16314473		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16473553, 22580984		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16473553		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15127973, 20522791, 20724130, 21655952, 22100366, 23786928, 25767384, 28203404, 28749959, 31632288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	12892443, 19236532, 20042743, 21047437, 21481333, 22819245, 24267395		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	20042743, 21047437, 22324469	Associate	★☆☆☆☆ Found in Text Mining only
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	BEFREE	21795050		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	22416915, 25573836		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	29249187		★☆☆☆☆ Found in Text Mining only
Chylopericardium	Chylopericardium	CTD_human_DG	20801906		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10632332, 22330637, 22863264, 23954207, 30292829		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	11872629		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	28223053	Stimulate	★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	12410334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	16001969	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	29171003, 29569150, 30476507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	CTD_human_DG	11820457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	18815359, 19617644, 20361960, 22039321, 27394986, 28383063, 28494341, 28556814, 28695925, 30137286, 30683827, 31204754, 9773924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	22301110, 30227886	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	Pubtator	25071069	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Collagenous	Collagenous colitis	Pubtator	25071069	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10980113, 16273614, 17653443, 30190207, 36272033, 37960728, 39596612	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10833474, 10866999, 10930401, 10931458, 11023534, 11114729, 11563634, 11731423, 11733561, 11825662, 12060668, 12423325, 12432918, 12433707, 12472107, 12615711, 12818365, 12832097, 12839952, 14520472, 14675489, 15150618, 15161935, 15240520, 15289320, 15517878, 15632146, 15695237, 15705869, 15713675, 15767339, 15788676, 15883203, 16091009, 16326073, 16391811, 16489533, 16622456, 16818639, 16841079, 16909108, 16972245, 17018629, 17145853, 17277882, 17459020, 17877615, 17981262, 18084318, 18097606, 18281498, 18320325, 18326857, 18587421, 18593902, 19244345, 19347284, 19437564, 19445018, 19549529, 19755647, 19790197, 20043083, 20046424, 20200425, 20332435, 21401528, 21668942, 21757690, 21882253, 21885812, 22002318, 22170686, 22329897, 22904679, 23580446, 23776069, 23869759, 24022467, 24383454, 24687028, 24998576, 24999478, 25545478, 25622900, 26498686, 26609171, 26707712, 26997150, 27344083, 27368132, 28212885, 28425852, 28454287, 28583134, 28587064, 28591725, 28657468, 28718684, 29049411, 29068698, 29215713, 29358223, 29899846, 30183370, 30570856, 30813251, 30820968, 30959857, 31100474, 31844085, 8643486, 9151799, 9327228, 9596581, 9831333		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	16085694, 17640979	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10433483, 11150521, 11309440, 15574495, 15713675, 15788676, 16319132, 16880406, 17369603, 18790560, 19208339, 19773434, 20046424, 21081470, 21459756, 26609171, 31038736, 31617778, 8643486, 9443907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	10930401, 11150521, 11880271, 11986787, 12578839, 15274299, 15632146, 15713675, 18381589, 18587421, 20069397, 21459756, 23580446, 25169526, 8643486	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11705852, 12124799, 12598658, 12767532, 12839952, 14675489, 15574495, 15896711, 16203768, 17128412, 17178865, 18326857, 19088039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	12189188, 17667525, 21081470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	7926468	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	18214062, 20864903	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	37756582	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10204802, 10398082, 10419916, 10528897, 10545404, 10766162, 10930401, 11062695, 11087869, 11228540, 11342898, 11396184, 11469677, 11687726, 11687954, 11729113, 11751489, 11857443, 11948369, 12048163, 12110643, 12208739, 12353842, 12405290, 12494894, 12626523, 12736102, 12818365, 12839952, 12941199, 14585257, 14719128, 14719154, 14965325, 14976201, 15013430, 15075004, 15156159, 15173859, 15188000, 15285012, 15285921, 15300574, 15501074, 15526363, 15622585, 15695237, 15816542, 15867236, 15908664, 15923435, 16205694, 16293616, 16343055, 16391837, 16413466, 16510588, 16540660, 16551850, 16818638, 16818642, 16820091, 16821623, 16909108, 16985019, 17151091, 17178865, 17290397, 17374999, 17594159, 17604853, 17710160, 17767717, 17875695, 17981262, 18094611, 18230181, 18281498, 18320325, 18350611, 18648741, 18692059, 18720000, 18794809, 18957522, 19010907, 19075598, 19102009, 19147569, 19219602, 19277703, 19307727, 19412426, 19412621, 19505922, 19549529, 19571664, 19597346, 19638987, 19777615, 19930591, 20027603, 20075740, 20087348, 20145612, 20160714, 20507599, 20514410, 20548327, 20571967, 20728343, 20803081, 20808059, 20846456, 20876365, 21071513, 21071999, 21158711, 21166741, 21205744, 21296766, 21509397, 21910156, 22049153, 22082586, 22170686, 22173719, 22524803, 22614156, 22710400, 22751903, 22904679, 22950494, 23167360, 23300952, 23527044, 23531863, 23543356, 23595116, 23715757, 23776069, 23810915, 23851494, 24022467, 24142638, 24171795, 24194923, 24274457, 24383454, 24733273, 24760190, 24870748, 24889212, 24969885, 24998576, 25166592, 25169526, 25239119, 25310697, 25322760, 25381814, 25422199, 25818893, 25835114, 26159723, 26482433, 26493186, 26707712, 26844701, 26950454, 26957558, 27207660, 27806345, 27810226, 28139497, 28178650, 28188432, 28260506, 28338176, 28402256, 28423516, 28448072, 28449470, 28454270, 28601236, 28786533, 29037225, 29068698, 29158365, 29229353, 29238715, 29339153, 29421522, 29552221, 29552755, 29562216, 29566186, 29580751, 29617306, 29769213, 29770434, 29782360, 29853736, 30008836, 30012671, 30034467, 30106414, 30183370, 30186819, 30260024, 30269738, 30480806, 30484108, 30622375, 30638861, 30700940, 30720004, 30826660, 30931980, 30941311, 31120230, 31205515, 31223291, 31313358, 31540047, 31614548, 31620100, 31725282, 31734182, 31797003, 7926468, 8566864, 9464487, 9703885, 9809985, 9850081, 9858896		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	10485483, 11375891, 12837940, 15753380, 19671906, 20427397		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10204802, 10419916, 10471521, 10945606, 12414664, 12494894, 15075004, 15300574, 15695237, 16818642, 19035518, 21158711, 24383454, 26498686, 30656820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	10485483, 11375891, 12837940, 15753380, 19671906, 20427397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10517910, 12598658, 14521608, 15574495, 19016757, 19088039, 19638987, 25169526, 25545478, 25738332, 28402256, 29158365, 30700940	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10917546, 10920275, 10930401, 11733561, 12771929, 12800231, 12970891, 14719508, 15150618, 15156159, 15173859, 15274299, 15285012, 15328521, 15475936, 15517878, 15637743, 15655349, 15655524, 15713675, 15723653, 15754389, 15930344, 16099783, 16237757, 16619535, 16709411, 16799479, 17277882, 17437271, 17522398, 17579859, 17594159, 17640979, 17767717, 17877615, 18084316, 18310926, 18326857, 18350611, 18587421, 18636671, 18794809, 19017360, 19037088, 19390125, 19513071, 19558693, 19636412, 19671906, 20046424, 20087348, 20145612, 20200425, 20332435, 20348947, 20548327, 20635443, 20717114, 20864903, 21262972, 21757690, 21822307, 22544606, 22553404, 22929917, 23013454, 23144866, 23300952, 23322982, 23349017, 23359190, 23531863, 23629521, 23869759, 24022467, 24194923, 24694755, 24983372, 25166592, 25310697, 25381814, 25741148, 25755742, 25818893, 25835114, 25854428, 26107817, 26220687, 26482433, 26497206, 26759006, 26957558, 27040803, 27074568, 28178650, 28188432, 28787469, 28934138, 29188362, 29853736, 30106414, 30813251, 30826660, 31244287, 31734182, 32168749, 32655010, 34314467, 34700376, 35054980, 36183698, 36430918, 36759733, 37654195, 37661645, 37790614, 8643486, 9012840, 9263538	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11992399, 12405290, 12600292, 12664576, 12727794, 12771929, 12800231, 15102673, 15173859, 15248379, 15285012, 15328521, 16174078, 16237757, 16474989, 16820091, 17151091, 17594159, 17604853, 18794809, 19016757, 19047118		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complex partial seizures	Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18988310		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17418864		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23900502, 26276523, 26518876, 28728977, 29872269, 30753687		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	34418699	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	23681850		★☆☆☆☆ Found in Text Mining only
Congenital Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	16240160		★☆☆☆☆ Found in Text Mining only
Congenital secretory diarrhea, sodium type (disorder)	Congenital secretory diarrhea	BEFREE	30091812		★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	22907529		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11115075, 11499548, 18802217, 28569569, 30232741, 30245627, 31015404, 31073922, 31229551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20304815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive Ophthalmopathy	Congestive Ophthalmopathy	CTD_human_DG	17614770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719128, 15049901, 15538221, 15569051, 17451187, 25275044, 25973014, 27926489, 28155120, 31423209		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	31073609		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	14642682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18385811, 18989535, 19046748, 19631939, 20332714, 21091235, 21574137, 24446343, 24513487, 29725388, 31700919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	14642682		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	14642682, 24736319, 24796340, 28194409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	18385811, 18989535, 19046748, 19631939, 20332714, 21091235, 21574137, 24446343, 24513487, 28194409, 28860667, 30345832, 31700919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	18989535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	19046748, 20332714, 28629174, 35866783	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17350020, 17495879, 18385811, 18989535, 19046748, 19631939, 20332714, 21091235, 21574137, 23681850, 24446343, 24513487, 28629174, 30367682, 31700919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	16399867	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	15940133		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	12642362, 16273614		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16273614, 16951496, 19148357, 21124790	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18819034, 20803508, 21124790, 29620794, 31184596, 9679035		★☆☆☆☆ Found in Text Mining only
Curling Ulcer	Gastric ulcer	CTD_human_DG	12481160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing's symphalangism	Proximal symphalangism	Pubtator	18190720	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10569809, 11196178, 19039588, 29794562, 30575644, 31675116		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	30710830		★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	31749137		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15964894, 23090667	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21605700, 21913191, 22185734, 30177416, 31351192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis	Cystitis	BEFREE	19675284, 22634839, 30552456, 31375151, 31467580		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	24387269	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	22738385	Associate	★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	BEFREE	10487525		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	28536720		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11840453, 12374621, 15313405, 16257278, 16476713, 18471798, 18802112, 20090528, 20378913, 20862685, 20870807, 21506092, 22114888, 22294637, 23396231, 23611898, 23838114, 23964078, 25496568, 26505439, 27515563, 27731497, 27751171, 28274742, 28413731, 28536229, 28778815, 28983624, 29112682, 29245931, 29328479, 29356224, 29385156, 29453810, 29484338, 29601910, 29663159, 29691435, 29890262, 29890922, 29930022, 30086786, 30120508, 30216103, 30233731, 30391743, 30498758, 30510777, 30556497, 30707846, 30938133, 31073922, 31148341, 31190973, 31495059, 31497826, 31547612, 31557835, 31564512, 31666999, 31765607, 31784400, 9077531, 9433877, 9858439		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21905285, 24341417, 30400733, 30665389		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16331303		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	26577108		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	30398124, 31630035		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	19356723		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12397273, 20034614, 20588070, 21655952, 22580182, 28038393, 28108057, 28352129, 28927045, 29879605, 30526621, 31022424, 31539536		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	19356723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20034614, 20588070, 21655952, 22331023, 22580182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23852407	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	19356723		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26950613, 28358324, 28409880, 28887839, 28912118		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	18769189, 31137528		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	15451306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	24443892	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	27942866		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15544519, 16341840, 17192482, 26920155, 28223053, 28490532, 28985857, 29385156, 29464270, 29511456, 31593087		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31061324	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15544519, 16341840, 17192482, 26920155, 28223053, 28490532, 28985857, 29385156, 29464270, 29511456, 30498345, 31593087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	15885672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	23360427, 23642086, 28223053, 28985857	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	24751283, 37033970	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24204704, 25946000	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35954211	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39217825	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10449443, 17130490, 24204704, 25946000, 25974252, 27815317, 28490532		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12920574, 17595242, 25095741, 29385156, 30293595, 30629897, 31105125, 31593087		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12920574		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11499548, 21114363, 33274236, 35932042, 36329882, 36482994, 38013385, 38206700, 39378104	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11499548, 14514642, 17263765, 27121697, 27815317, 28490532, 29154978		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	14514642		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12821538		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26822858		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29626212, 36689408	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	18758643, 24201754	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	19048457		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	19809523		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31187468		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	25339021	Associate	★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	25666316		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11850029, 28677372		★☆☆☆☆ Found in Text Mining only
Drusen	Drusen	BEFREE	18538409		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	22858125		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	12907138, 16507397, 17465194		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	12907138, 16169726		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	CTD_human_DG	12481160		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duodenitis	Duodenitis	Pubtator	15930344	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	12767095	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyggve-Melchior-Clausen syndrome	Dyggve-Melchior-Clausen Disease	BEFREE	29974839		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	26083362		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26083362	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35227068	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29109760, 31378878, 31420920		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18769189, 31137528		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28779848	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	25873764		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	16775385, 18006935, 24455696, 28352122		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	19356723		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	10952941, 11228540, 11592775, 16081631, 18316157, 21589857		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11957147, 12209724, 15016316, 15067356, 15342458, 15809736, 21687953, 23453006, 23873111, 24100466, 25900875, 26468779, 26546977, 28474124, 29404887, 30168128, 30488858, 30930224, 31533599		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	11957147, 12209724		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	12209724, 17354612, 37603513	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11228540, 12209724, 15016316, 15546508, 15598938, 16884383, 17354612, 17970040, 18204294, 18316157, 19154413, 19407554, 19509570, 19756737, 19891660, 21589857, 21816851, 25900875, 26111272, 30488858, 33573388, 35876160	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11957147, 15609300, 15944924, 16884383, 17624083, 17970040, 18097584		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	30488858		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	28438620		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	19401614, 20068324, 31714804		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	25446850		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12322896, 14998974, 15483103, 16123052, 17295901, 18039779, 18930197, 19299454, 19401614, 19647233, 20068324, 21145050, 21613300, 22130322, 22587873, 22608095, 23239446, 23252918, 24423291, 24423359, 24939730, 26153366, 27038655, 27695098, 28281561, 28548231, 28673205, 28734688, 30402023, 30773096, 31074246, 31247078, 31527378, 31714804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	LHGDN	14505259, 15533352, 15979990, 16456945, 17156191, 17295901, 18048499, 18053993, 18079209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	15533352, 18048499, 21601196, 23239446, 23962610, 24133591, 35130311, 39458478	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	22608095	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	25446850		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	15150127		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28005266		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	LHGDN	15254709		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	28769765		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	12470703, 37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28017780, 28352122, 29593494, 30030837, 30484341, 30506635, 30521407, 30794658, 31011358, 31666079		★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	17135033	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	12470703, 37946105	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	12470703		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17309668, 17667594, 19621391, 28599493, 29324448, 29727350, 29932878, 31817839		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	17767717, 19147569		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11410869, 11821953, 15151617, 15259059, 15978332, 16083713, 16299228, 16322294, 17511025, 17650224, 18443952, 19280666, 19630103, 21304218, 23393346, 24206575, 24284961, 24641411, 26474693, 28652771, 29254791, 29893307, 30535495		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	11059772, 16322294, 17707579		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11410869, 11821953, 15151617, 15259059, 15978332, 16083713, 16299228, 16322294, 17511025, 17650224, 18443952, 21304218, 24206575, 24284961, 24641411, 26474693, 28652771, 29893307, 30535495		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	14633942, 15259059, 15685829, 17511025, 19630103, 19633925, 21779349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15259059, 16083713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12698187, 15259059	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17220580, 18583546, 18632220, 19463183, 19630103, 21157974, 21468258, 24641411, 25422234, 26323923, 30339710	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esophagitis	BEFREE	15249402, 15878911, 16863546, 20811626, 21451212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esotropia	Pubtator	20811626, 26914122	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	12024286		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	28085506		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	16818635		★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye neoplasms	Pubtator	19925514	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	16331303		★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	17764114, 18004747, 22610071		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	16831027	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	15205347, 15585388, 15878911, 16521222, 21304218, 21969813, 21971589, 22258871		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31222118, 31247902, 31282064		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30382148		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	27871023		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22553222, 29901153		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	11313976		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	11313976, 17785554, 28851389		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	21071999		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18503750, 22863264, 24496160, 28238769, 28259935, 29109031, 29174446, 29234949, 30139224		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	15817909, 15947945, 16362262, 20640858		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	11939728, 15879365		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	25104852		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	11920595, 11948128, 16733863, 17177652, 19455278, 21283657, 28521485		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15968728, 16733863, 17177652, 21283657	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	11223821, 11448905, 12532441, 17006983, 18330937, 22610150, 24992958, 27314294, 29767663		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	10487525, 11028754, 11136275, 11519793, 15599211, 28011266, 28322956, 28342204, 29397336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	CTD_human_DG	10594344, 11376495, 12481160, 19066340, 9024292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	LHGDN	15246970, 15720413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	Pubtator	10235197, 34471638	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	10980112, 12485915, 18775915, 18825488, 18985541, 23053397, 24127267, 27079437, 31073922, 9773924		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	15720413		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	39259113	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	12645788, 16762620, 18825488, 26674784, 31320912		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	15249402, 15585388, 17581270, 24357184, 29948304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	CTD_human_DG	21451212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	12483719	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	16712734, 17934641, 18632220, 30339710	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	22218775, 23001726		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29158365	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	17230613, 21133589, 22654456	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19845533		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	12352459		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21779349, 31162032		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	12892443		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	22324469	Stimulate	★☆☆☆☆ Found in Text Mining only
Gitelman Syndrome	Gitelman Syndrome	BEFREE	28700713		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	CTD_human_DG	16330497		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	11581208, 19953083		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	CTD_human_DG	16330497		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15105053, 15383564, 17640083, 18006935, 19809523, 20145033, 22406049, 24621265, 24659686, 25409926, 26410343, 27693715, 27824617, 28333553, 28718447, 29137258, 29152086, 29247872, 29719610, 30118847, 30506802, 31601050, 31652556		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15816645, 18181832		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15816645, 16133570, 25409926, 28333553, 35163465, 35337344, 40312983	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15105053, 15383564, 17640083, 18006935, 20145033, 22406049, 22986533, 24621265, 24659686, 25409926, 26410343, 27693715, 27824617, 28718447, 29137258, 29152086, 29719610, 30118847, 30506802, 30761522, 31601050, 31652556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	11563634, 15361550, 15383564, 15465602, 17616668, 17729162, 19029777, 19169273, 19272160, 19925030, 20406895, 21220497, 21763744, 22406049, 24659686, 25966079, 26097553, 28306608, 28789345, 28800785, 30740906, 30740911, 31438982, 31652556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	15361550, 17616668, 19029777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	15561105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	19029777, 20406895, 23635401, 25966079, 28333553, 31652556	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	30740906	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	19900134	Inhibit	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	8736403		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15882262	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28040266		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35524416, 36123941	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30317551		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18988310		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33488522, 34383782, 9792671	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	10405195, 14694045		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	10405195		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	12650805, 12912958		★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	BEFREE	12650805, 14623934, 17325551		★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	9823297		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11939728, 15817909		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11326316, 12698187, 14566822, 15155138, 17354234, 17364333, 17624243, 17764107, 19280666, 19755515, 21656078, 24724948, 29228752		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	11326316, 24950702	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	12698187, 15375804, 18172254		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	12698187	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10825178, 11115075, 17198778, 32105387	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	18802217, 28569569, 30232741, 30245627, 31015404, 31073922, 31229551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	20304815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21187081, 22971811, 30683818, 31846957		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	15882262	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	30303592		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	22324469	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21957142	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15479690, 24496160	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	18092051	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	21179273, 23091809	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20676755, 24789723	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	10404093, 17003101, 17224647, 22385256		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	29040306		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10419916, 14585257, 16551850, 16835340		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12353842		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17064999, 30349293		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20346139	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	CTD_human_DG	22430074		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperaldosteronism	Hyperaldosteronism	Pubtator	39252231	Associate	★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	CTD_human_DG	11820457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	BEFREE	28212299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	LHGDN	14514642, 14749287		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	14514642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	17595242, 23059845, 28556994		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	35607962	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29413962		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	25727911		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	29982796		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	20471507, 29982796		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	22588264	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Immediate	Hypersensitivity	Pubtator	16965632	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11499548, 29996846	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, Renovascular	Hypertension	BEFREE	14501677		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11499548, 12391278, 15167446, 15892676, 17641732, 19577709, 20724703, 23953622, 25846103, 27814606, 28054752, 28556994, 28569569, 29020251, 29201221, 29468706, 29698447, 30156911, 30354807, 31073922, 31183001, 31378107, 31745719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	14757778, 15834289, 20667508, 22349312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	17198778	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	36123941, 39796505	Associate	★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	29220411		★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Hypophosphatasia	Pubtator	16803637	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29436670		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12050157, 14702352, 15220111, 15334456, 17456758, 17640750, 18936210, 23144021, 24325753, 24471568, 24574272, 29384693, 37540709	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15550400, 19017360, 20042640, 21533553	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28856805, 29565041		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	22170686		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23681850, 26922534, 29449428		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11980586, 15127973, 19487460, 21319594, 22859522, 23742950, 23755232, 24652950, 26744410, 27993290, 7706493, 9823297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	19487460	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24652950, 7706493	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	23973990, 30668431		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	39252231	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	27715371		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16528365, 17510310, 18468574, 29132227		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16001969, 19038899, 29171003, 29325450, 30476507		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24471989	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	11820457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12494894, 12702972, 16273614, 17214885, 18596194, 18815359, 18819034, 20361960, 20803508, 21124790, 24967898, 27508514, 28948903, 29630407, 30186819, 31184596, 9679035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16273614, 17214885, 17640979, 19636412	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	14735188, 28978083, 31206365		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26950613, 28409880, 28912118		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	28990061		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	33274236	Associate	★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	19706240	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31257475		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30210652		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33764282, 34707460, 37340393, 39528158	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disk Displacement	Intervertebral Disk Displacement	BEFREE	17631744		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	10668484, 9151799		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	14738710, 28587496, 30590313		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16097073, 19522023	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23161322	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	10668484, 15150127, 15622585, 24338666, 9151799		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18758643	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	22588264	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	24685329		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	34418699	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	34185176	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	20192574	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	CTD_human_DG	10582676, 10873095		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	12957358, 16550596, 17530268, 19843025, 22575501		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	16818635		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16428471, 18199541, 21153458, 21476934, 24950714, 28927045, 29250535		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	21153458		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30186819, 30854791		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16879213, 19046748, 19485927, 19631939, 21816595, 23907768, 27363623, 28704403, 28948649, 31222746, 31735164, 9616775		★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	30328712		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Juvenile polyp	Polyp	BEFREE	19124115		★☆☆☆☆ Found in Text Mining only
Juvenile Polyposis Coli	Juvenile polyposis syndrome	BEFREE	27072264		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	17325551, 19124115, 27072264		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	20388794, 20943963, 23567332, 24244164		★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	24581331, 24831259		★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	22413864		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	19643929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	21114363, 29295852, 29676940, 30025388, 9644630		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	21114363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	17584101		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28569136, 28614595, 30084579, 30870859, 31195118		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19420110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	26543101, 29982796		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17645803, 38002360	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	15162003		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25736926, 33099940	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	24321753, 24374907, 29492204		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	31229551		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25001017	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17483309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leiomyosarcoma	Leiomyosarcoma	CTD_human_DG	18645019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyosarcoma	Leiomyosarcoma	Pubtator	21412163	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyosarcoma, Epithelioid	Leiomyosarcoma	CTD_human_DG	18645019		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	CTD_human_DG	18645019		★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	31112872	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11506967, 21848701		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20673699	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39251712	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	29040306		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15368354, 15547942, 21848701, 23973990, 26342105, 30674535		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	25957909		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29440919		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	20599939		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	18202791, 18234542, 20599939		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	CTD_human_DG	18202791		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	18307244		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	18619641		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	17761345		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12542827, 12738747, 12747975, 15756036, 17354234, 17595767, 17624243, 18356024, 18922923, 19197984, 19278989, 19910795, 23250779, 25977924, 28740192		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	25973067	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10632332, 11915030, 12115513, 12378621, 12488433, 12901877, 12926063, 14507645, 15156159, 15218507, 16273635, 16331686, 16391822, 16419156, 16724692, 17074019, 17097688, 17178883, 17964630, 18443952, 18506760, 18722373, 19058305, 19329856, 19887546, 20515870, 20858479, 21042835, 21319995, 21356386, 21743491, 21801152, 22009181, 22097969, 22242948, 22330637, 22340386, 22378232, 23124652, 23226427, 23494177, 23776502, 23954207, 24398550, 24675684, 24720952, 24721996, 24759835, 25231214, 25400773, 25730260, 26081696, 26334888, 26438136, 26554780, 26851630, 26881519, 26984380, 27109804, 27173352, 28317866, 28342979, 28346420, 28802237, 29131381, 29505957, 29514844, 29578159, 29693167, 29725404, 30182439, 30287340, 30346255, 30365092, 30643357, 30653402, 30713782, 30810331, 30854092, 30930224, 31059053, 31114336, 31142342, 31213849, 31423564, 31563690		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	11872629, 12024111, 14563831, 16374840, 17510421		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15010822, 15156159, 16331686, 19082453		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10632332, 21319995, 22330637, 22863264, 23954207, 28259935, 30292829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	15055524, 15479690, 21179273, 27982164, 36246566	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	15479690, 18092051	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	17964630, 26482123	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	19017995		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	LHGDN	19017995		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16419156, 22242948, 23226427, 23954207, 24398550, 28317866		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15127973, 19577709, 21681100, 23742950, 27188849		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	15863442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	17201164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	19084589		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	11882767, 20606309	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12086404, 12393872, 12591723, 12789263, 14597555, 14604894, 15375805, 15704107, 15777967, 15870920, 16278387, 16786043, 16820889, 17611676, 17851225, 18453539, 18496814		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12591723, 17363603, 19147569, 20353998, 25057941, 25909170, 29348400		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12686753, 12708493, 15494493, 16034085, 16421596, 16542464, 19755515, 20353998, 21150337, 21572400, 22464751, 22761909, 23943857, 24098479, 24344016, 25465874, 26430963, 26744864, 26863638, 28972958, 30131302, 31347609, 32521872	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25113252	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	16871410		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36482627, 36871016	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	16871410		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16871410, 22801788		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	17761345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	18459455		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30025388, 9644630		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	16871410		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	24395886, 25347447		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	12532441, 16260857, 20608938, 22735610, 22751903, 28188432, 28927045, 30087034		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12532441, 15272284, 18319253, 19300368, 20192574, 22371637, 26323923, 26423666, 27057636, 28188432, 28425432, 30106414	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18190720, 19509584, 24887090, 26498465, 27457107, 33327467	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	16314473		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11585835, 17671709, 18038187, 22670565, 24637636, 31187468		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	14654083, 17325901, 17671709, 17823287		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16790692	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16790692, 25900875	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	18038187		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	20428208		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20034614, 21168919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	21168919, 28108057, 31214060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	16489006		★☆☆☆☆ Found in Text Mining only
Malignant Central Nervous System Neoplasm	Malignant neoplasm of the central nervous system	BEFREE	25134430		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	14981912, 17094458, 17233833		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	15561105		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17616668, 21220497, 23635401, 28306608		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11326316, 12698187, 14566822, 15155138, 17354234, 17364333, 17624243, 17764107, 19280666, 19755515, 21656078, 24724948, 29228752		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22095628		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	31063993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10402236, 10569809, 11501838, 11897504, 11901151, 11912139, 12063562, 12359744, 12455057, 12472107, 12736714, 12740157, 12825860, 12902864, 12907138, 14499627, 14648704, 14735188, 14993030, 15033780, 15623590, 15642177, 15741054, 15753376, 15809733, 15833882, 15856465, 15923426, 15967164, 16030101, 16213894, 16243823, 16287071, 16353170, 16391819, 16480277, 16489098, 16498361, 16507389, 16507397, 16650963, 16712450, 16870006, 16885386, 16888001, 17156488, 17181859, 17214885, 17332916, 17352244, 17418864, 17479405, 17510310, 17542993, 17580278, 17612393, 17624587, 17657731, 18001219, 18045954, 18090122, 18192694, 18199541, 18202791, 18386173, 18483177, 18663571, 18953425, 19138835, 19190350, 19241157, 19244345, 19276290, 19390242, 19428334, 19576865, 19940361, 19965896, 20033767, 20211985, 20229271, 20536410, 20608938, 20631072, 20676755, 20711808, 20876365, 20878073, 21047437, 21059239, 21071999, 21078168, 21153458, 21310944, 21476934, 21533532, 21655952, 21796157, 21813027, 21907301, 21953546, 21971413, 22037828, 22213327, 22242594, 22286316, 22333315, 22938493, 23029485, 23098208, 23275522, 23385883, 23566419, 23792017, 24325753, 24402873, 24434582, 24535190, 24590894, 24789723, 24859472, 24923427, 24927687, 24950714, 24998576, 25060643, 25214704, 25242400, 25323004, 25368279, 25374215, 25433948, 25476497, 25511800, 25520090, 25520137, 25667510, 25733698, 25754990, 25773924, 26227474, 26359357, 26416248, 27301070, 27323060, 27530354, 27632554, 27779707, 27821648, 27835884, 27994517, 27999206, 28029661, 28054666, 28056899, 28152501, 28240006, 28393249, 28486908, 28490464, 28571770, 28605338, 28618256, 28663087, 28666869, 28709031, 28808873, 28906164, 28927045, 28964785, 29202630, 29250535, 29321183, 29321644, 29501042, 29550515, 29587668, 29596308, 29658109, 29661238, 29928417, 30314513, 30338705, 30339576, 30539699, 30702971, 30747082, 30769266, 30970220, 30999962, 31185986, 31195426, 31203442, 31289003, 31300611, 31349508, 31494294, 31506784, 31524251, 31534346, 31623608, 31638237, 31759380, 31783895, 9521170		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16127422, 16870006, 17285134, 18498876, 18509974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11957147, 15016316, 15067356, 15342458, 15809736, 21687953, 24100466, 25900875, 26468779, 29404887, 30168128, 30488858, 30930224, 31533599		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	11059772, 16322294, 17707579		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11410869, 11821953, 12893070, 15151617, 15259059, 15978332, 16083713, 16299228, 16322294, 17511025, 17650224, 18443952, 21304218, 24206575, 24284961, 24641411, 26474693, 28652771, 29893307, 30535495		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	19455278, 21283657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10070951, 11023534, 12483244, 12664575, 15285921, 15574495, 16552798, 16712734, 17691999, 18632220, 18648741, 20381235, 24969885, 28405152, 29982219, 8931116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28155120		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	12782823, 28739688		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11915030, 16273635, 18722373, 21410330, 21800055, 22340386, 24969885, 26984380, 28246472, 28728977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10353732, 10665651, 11208460, 11320076, 11464289, 11494020, 11882767, 12686753, 12708493, 14597555, 14967078, 15765920, 15777967, 15825163, 15829319, 15882925, 16376453, 16397226, 16542464, 16786043, 16912160, 17214885, 17342322, 17342342, 18164040, 19217709, 19409031, 19755515, 19918789, 20530427, 21150337, 21198273, 21461558, 21678473, 22160576, 22292629, 22464751, 22696230, 22761909, 23065687, 23943857, 24098479, 24337484, 24344016, 24909729, 25004182, 25047043, 25113252, 25137041, 25175164, 25465874, 25797267, 26430963, 26452035, 26600514, 26624903, 26744864, 26774881, 26863638, 27450326, 28150906, 28173828, 28282799, 28709031, 28979299, 29025423, 29113232, 29345286, 29408308, 30114468, 30131302, 30170377, 30365050, 30591531, 31186812, 31231223, 31347609, 7706493, 9515807, 9731479		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	12542827, 12738747, 12747975, 15756036, 17354234, 17595767, 17624243, 18356024, 18922923, 19197984, 19278989, 19910795, 23250779, 25977924, 28740192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	12969226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11489832, 12469191, 12615701, 14633672, 14647459, 14719060, 14729623, 15269139, 15781636, 15838264, 15963707, 16044148, 18090132, 18306389, 18362203, 18798061, 19621391, 20559705, 21756326, 23978451, 24718658, 25335121, 28599493, 29152148, 29932878, 30647111, 31822119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10070951, 10485483, 10657949, 10953335, 11781662, 12504222, 12533667, 14517802, 14656949, 15492268, 15542781, 16083499, 16373709, 16481301, 16807445, 17131340, 17172427, 17369849, 17652141, 17921715, 17950526, 18437081, 18665070, 19422084, 20530583, 21343834, 21408027, 21705955, 22039326, 22200969, 22829202, 22898640, 23924856, 23973710, 24146280, 24520096, 24912820, 24969885, 25152585, 25497868, 26035123, 26691217, 27368132, 28260499, 28352075, 28815606, 29565462, 29896263, 29963167, 30254182, 30333153, 31355777		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	10485483, 10657949, 15705899, 16820089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	10753955, 14754878, 15126378, 16506214, 17609663		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11289153, 11751373, 11913955, 12386924, 14613585, 14754878, 15240520, 15287094, 15374967, 15550400, 15878913, 15930345, 16506214, 16585199, 16731743, 16954428, 16956712, 17066444, 17265445, 17434257, 17609663, 17695530, 17764114, 17911400, 17998819, 17999989, 18030357, 18089846, 18242387, 18645679, 18974063, 19318492, 19488068, 19772879, 19776642, 19836060, 19965896, 20388081, 20431935, 21273602, 21308720, 21430074, 21745389, 22023987, 22435969, 22763881, 22782583, 23053989, 23646189, 24155892, 24203817, 24324057, 24324075, 24802614, 25446255, 26535654, 26788504, 26920155, 27232854, 27480340, 27647999, 28368394, 28450158, 28567040, 28941222, 29088783, 29242151, 29599304, 29765153, 30098292, 30367494, 30673592, 31157709, 31626054, 31816863, 9766645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12370831, 17488409, 24469308, 25320180, 28230039, 28724634, 29156646, 29568008, 29714143, 30118847, 31571864, 31689521, 9635856		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	17499752, 19748995, 21159610		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10404093, 11192946, 11223821, 11310828, 11403917, 11535962, 11606854, 12203123, 12532440, 12532441, 12606945, 12684668, 12695555, 12746473, 12767510, 12781040, 12883469, 14532971, 14962510, 15245777, 15334675, 15692787, 15890232, 15914275, 15929174, 16082585, 16097070, 16101131, 16243808, 16260857, 16339564, 16762620, 16949912, 17971584, 17982644, 18068001, 18311113, 18373164, 18611916, 18618313, 18985541, 19196394, 19201083, 19463183, 19491270, 19661089, 19940363, 20364406, 20649594, 21086572, 21266034, 21275453, 21494638, 21538574, 21649724, 21976141, 22385256, 23001726, 23013439, 23670240, 23775011, 24023834, 24127267, 24533777, 24761915, 24935598, 25038797, 26067133, 26391267, 26514342, 26674784, 27020655, 27079437, 27314294, 27352184, 28405152, 28624843, 29151957, 29254791, 29358963, 29434905, 29616098, 29767663, 30003735, 30391440, 30941969, 31045826, 31473273, 31491956, 31518663, 31534549, 31632572, 31792089, 9872498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	10404093, 17003101, 17224647, 22385256		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	11788675, 31113934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	CTD_human_DG	16543248, 22561872		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	10582676, 10873095, 12442003, 12664575, 16098373, 17093206, 29396848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10880372, 11342898, 11694654, 11827414, 12197220, 12352459, 12442003, 15240520, 15596291, 16596191, 18367112, 18617357, 20582552, 20627335, 22288910, 23705854, 24324075, 25109742, 25196524, 30482227, 31198976, 31443756, 31497247, 31775672		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10404093, 10487525, 10632332, 10657949, 10778945, 10783318, 10797288, 10953335, 11192946, 11208460, 11234900, 11238189, 11289153, 11342898, 11410869, 11448905, 11469677, 11501838, 11584358, 11687726, 11751489, 11781662, 11788675, 11823979, 11827414, 11857443, 11882767, 11912139, 11957147, 12051953, 12063562, 12102579, 12110643, 12384982, 12494894, 12499915, 12504222, 12615701, 12747975, 12777984, 12900768, 12901877, 12957358, 12963227, 14499627, 14519750, 14521714, 14550281, 14555660, 14555963, 14566822, 14594546, 14640580, 14640918, 14719154, 14960510, 14962510, 14965325, 14965326, 14967078, 14976201, 14981912, 15049901, 15087410, 15120641, 15156159, 15217498, 15234907, 15259059, 15274299, 15285012, 15285921, 15287094, 15300574, 15313405, 15328200, 15374967, 15383564, 15455372, 15483103, 15492268, 15547942, 15596291, 15608668, 15622477, 15695237, 15695412, 15704107, 15753376, 15788676, 15809733, 15809736, 15825163, 15833882, 15838264, 15867236, 15878911, 15947945, 15979837, 16044148, 16083499, 16083713, 16097070, 16097073, 16101131, 16104877, 16299228, 16326109, 16337272, 16339564, 16376882, 16391811, 16391837, 16413466, 16463383, 16510588, 16731743, 16823844, 16908593, 16989810, 17222248, 17237818, 17265445, 17341442, 17354234, 17404026, 17404027, 17418864, 17434257, 17447067, 17460548, 17479405, 17578436, 17594159, 17652141, 17906315, 17968676, 17999989, 18078766, 18094611, 18164040, 18192694, 18197933, 18199541, 18240541, 18311113, 18356024, 18443952, 18596194, 18927599, 18953425, 18985541, 19048457, 19075598, 19082515, 19102009, 19123475, 19244345, 19272160, 19278989, 19280666, 19318580, 19347284, 19421193, 19422084, 19445018, 19639178, 19669667, 19748095, 19755647, 19845533, 19925030, 19965896, 20015407, 20028875, 20046424, 20178602, 20179228, 20200425, 20353998, 20381235, 20392831, 20446020, 20530427, 20530583, 20594217, 20615394, 20686383, 20728343, 20808059, 20846124, 20876365, 20943963, 20960565, 20969859, 21042835, 21059239, 21071999, 21078168, 21166741, 21177768, 21187081, 21205744, 21304218, 21375766, 21401528, 21430074, 21478098, 21486220, 21656078, 21678473, 21687953, 21705955, 21734230, 21792195, 21793834, 21822307, 21848701, 21882253, 21968189, 21981137, 22017396, 22200969, 22213328, 22258871, 22503318, 22718198, 22763881, 22904679, 22922684, 22993369, 23053397, 23105117, 23161610, 23172668, 23250387, 23261444, 23268324, 23289871, 23343963, 23349017, 23427297, 23435965, 23444045, 23567332, 23580446, 23670240, 23681187, 23756166, 23801169, 23869759, 23873111, 23893925, 23927563, 23967159, 24023834, 24325753, 24349176, 24383454, 24402873, 24438088, 24533777, 24535190, 24589238, 24590894, 24659686, 24747121, 24792472, 24870748, 24912820, 24950702, 24969885, 24992958, 24999478, 25060643, 25113252, 25166592, 25305454, 25310126, 25322760, 25368279, 25405520, 25449785, 25754990, 25964576, 26004412, 26134824, 26303353, 26343742, 26359357, 26430963, 26481188, 26518876, 26530100, 26554780, 26774881, 26881519, 26957558, 27016075, 27020655, 27104313, 27105172, 27109804, 27145282, 27173352, 27314294, 27494851, 27512995, 27558792, 27570080, 27894402, 27991692, 28053596, 28054666, 28152501, 28157665, 28231855, 28240006, 28277128, 28283800, 28300223, 28352075, 28397014, 28400769, 28402256, 28472126, 28489511, 28490464, 28521485, 28560423, 28586004, 28591725, 28624843, 28666869, 28765120, 28786533, 28892080, 28927045, 28935965, 28948694, 28971779, 28978083, 29137258, 29156646, 29158365, 29163789, 29235601, 29290789, 29295852, 29324448, 29341436, 29468988, 29481741, 29492489, 29514844, 29565462, 29578814, 29661238, 29681851, 29714143, 29788918, 29800798, 29804536, 29968808, 30008836, 30027502, 30031652, 30049816, 30073924, 30081353, 30082676, 30106181, 30108767, 30118847, 30143023, 30149323, 30196771, 30223141, 30263093, 30318526, 30325206, 30339710, 30341914, 30362831, 30396759, 30480806, 30647533, 30674535, 30683818, 30700940, 30701538, 30747998, 30843344, 30877972, 30941311, 30943209, 31009406, 31052167, 31132600, 31187468, 31210111, 31231223, 31310338, 31382305, 31480608, 31497247, 31506784, 31526853, 31562745, 31586705, 31641036, 31652609, 31655104, 31725282, 31726219, 31816246, 31846957, 9703885, 9823297, 9831333, 9872498		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	20155627		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	12698187		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11156216, 11234900, 11844819, 17404026, 17440114, 17578348, 20686383, 22729746, 24289600, 24528073, 26881213, 28881683, 31614548		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10866999, 10930401, 11114729, 11563634, 11731423, 11733561, 11825662, 12060668, 12423325, 12432918, 12433707, 12472107, 12615711, 12832097, 12839952, 12958170, 14520472, 14675489, 15150618, 15161935, 15240520, 15517878, 15695237, 15705869, 15713675, 15767339, 15788676, 15883203, 16091009, 16391811, 16458424, 16489533, 16622456, 16841079, 16972245, 17018629, 17145853, 17277882, 17459020, 17877615, 17981262, 18084318, 18097606, 18281498, 18320325, 18326857, 18587421, 18593902, 19244345, 19347284, 19437564, 19445018, 19549529, 19755647, 19790197, 20043083, 20046424, 20200425, 20332435, 20654727, 21401528, 21668942, 21757690, 21882253, 21885812, 22002318, 22329897, 22904679, 23776069, 23869759, 24022467, 24383454, 24687028, 24998576, 25545478, 25622900, 26498686, 26609171, 26707712, 26997150, 27368132, 28212885, 28425852, 28454287, 28583134, 28587064, 28591725, 28657468, 28718684, 29049411, 29068698, 29215713, 29358223, 29899846, 30183370, 30570856, 30650553, 30813251, 30820968, 30959857, 31100474, 31844085, 8566864, 8643486, 9151799, 9327228, 9596581, 9831333		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	12189188, 17667525, 21081470		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16127422, 16870006, 17285134, 18498876, 18509974		★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	21153458		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11501838, 11901151, 12907138, 16997132, 17465194, 17542993, 18386173, 19895368, 21078168, 21683430, 23029485, 23098208, 24535190, 24590894, 26416248, 27000374, 28666869, 29609579		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11901151, 12592372, 12667327, 12883688, 14681319, 14735188, 15050918, 15328200, 15330183, 15754118, 15809733, 16168133, 16489098, 16505480, 16596190, 16912190, 17156488, 17192687, 17214885, 17332916, 17479405, 17542993, 17952860, 18190720, 18192694, 18199541, 18262731, 18319253, 18334709, 18469157, 18498876, 18795070, 18953425		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16127422, 16870006, 17285134, 18498876, 18509974		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16127422, 16870006, 17285134, 18498876, 18509974		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	30713782		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29040306		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29187826		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	11403917		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	29521599		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	12596060		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	LHGDN	12665651		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	18045954, 19940361		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22707305, 28417956		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	19356723		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	17499752		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11196178, 12777984, 17499752, 18202806, 18722548, 19039588, 19724275, 19747926, 21384343, 22045024, 22486811, 22850568, 23112250, 23728342, 25060715, 26547585, 27010501, 27105172, 27494851, 27769779, 28231855, 28386327, 28604419, 28765120, 28865485, 28899685, 29297092, 29978476, 30575644, 30800067, 31675116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	12956275, 15014019, 16432453, 16718274, 17013098, 18297687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15251468, 15526363, 18537861, 21268068, 21910007, 32388516, 34497154, 36050601	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	17145863, 17499752, 18454317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	31081481		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17525632, 17961045, 19614683, 20054806, 23250387		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	17525632		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23250387, 32832554	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12397273, 20034614, 20588070, 21655952, 22580182, 28038393, 28108057, 28352129, 28927045, 29879605, 30526621, 31022424, 31539536		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19356723, 20034614, 20588070, 21655952, 22580182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	31214060		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	18594470		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	15115874, 18831511, 34404424	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18831511		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23729401		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	20122271, 34404424	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22110764, 28912780		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	17499752, 19724275, 27494851, 29978476		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	16731743		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	15546262, 23357220, 27792775, 28044053		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32997693	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18668543	Stimulate	★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	BEFREE	14508834		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	15561105		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	18371075		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth Diseases	CTD_human_DG	17682004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	19197984, 20388794, 22038215, 25579548	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	19737986	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	12969226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	15796182, 19197984, 23250779, 25051199, 27941877	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17354234, 18356024		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya Disease	Moyamoya disease	Pubtator	10559138	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30321073		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	30003391		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11535962		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	15222024		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15731178, 16497971		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15731178, 16247750, 16497971, 16847764, 25070817	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16046235, 16497971, 17588340, 19548309, 22971811		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17373929, 21795050, 29022246		★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	30317551		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	8462673		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20206383		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	11978490		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12702642, 15117884, 15138244, 15664882, 16879213, 18385811, 18991687, 19046748, 19327107, 19748095, 26543101, 28342204, 29030657, 29272017, 30145840, 30679074, 31278427		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	17868881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	31772617	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	12881220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	26305786, 30257377		★☆☆☆☆ Found in Text Mining only
Myopathic Ophthalmopathy	Myopathic Ophthalmopathy	CTD_human_DG	17614770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	BEFREE	10912924, 21795050		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15301234		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21114363	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	10390414, 11800371, 11994707, 12622742, 15480320, 17141086, 22185734		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16775120, 19251796, 22416915, 23441755	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25573836	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11381123, 16273277, 17968676, 18758376, 25060857, 25438689, 25669978, 26261650, 28301518, 28435473, 28732079, 29956730, 30038488, 30082142, 30087034, 30314699, 31298328, 31486495		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	11381123, 15858127, 19591688, 25553117, 26261650, 27765529, 31298328, 31486495, 33277861, 35073820, 36203533, 36555343	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	16080510	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	24210203		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	24210203, 28013313, 31490357		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10204802, 10353732, 10404093, 10471521, 10485483, 10595745, 10630643, 10668484, 10980113, 11087869, 11192946, 11208460, 11223821, 11306496, 11313976, 11320076, 11326316, 11346869, 11370818, 11403917, 11448905, 11469677, 11489832, 11501838, 11535962, 11563634, 11571629, 11595687, 11602250, 11687726, 11687965, 11733561, 11751489, 11772947, 11827414, 11844819, 11906190, 11920472, 11920515, 11920595, 11945149, 11948128, 11957147, 11980643, 12024286, 12197220, 12209724, 12218456, 12353842, 12386924, 12393863, 12405290, 12432918, 12470662, 12494894, 12504222, 12532441, 12533667, 12591723, 12626523, 12698187, 12708493, 12767510, 12777984, 12782823, 12811209, 12821346, 12875991, 12883469, 12957358, 12963227, 12966433, 14508829, 14508834, 14519750, 14532971, 14597555, 14616542, 14627349, 14640918, 14647459, 14719060, 14719154, 14735188, 14754878, 14965325, 14965326, 14965327, 14985703, 14993030, 15014019, 15016316, 15017587, 15049901, 15067356, 15075004, 15150127, 15259059, 15285921, 15287038, 15300574, 15313405, 15328200, 15328521, 15342458, 15374938, 15383564, 15455346, 15475935, 15480979, 15538221, 15550400, 15564149, 15569051, 15582199, 15622585, 15704107, 15781636, 15788676, 15790444, 15809736, 15825163, 15867236, 15923435, 15930344, 15947945, 15967164, 15978332, 15979837, 16035618, 16139560, 16174078, 16213894, 16260857, 16273277, 16293616, 16299228, 16322294, 16326073, 16343055, 16391819, 16507389, 16510588, 16518418, 16520894, 16528365, 16551850, 16552798, 16596229, 16618763, 16650963, 16707460, 16712734, 16724692, 16731743, 16740761, 16818637, 16818638, 16818642, 16820091, 16841079, 16888001, 16899616, 16908593, 16984727, 17096355, 17177652, 17241515, 17290397, 17308999, 17309668, 17342322, 17364333, 17369603, 17369849, 17384145, 17392171, 17418864, 17440100, 17440835, 17465194, 17510310, 17525632, 17624243, 17697767, 17710160, 17875728, 17921715, 17939563, 17948911, 17982644, 18068001, 18190825, 18230181, 18281498, 18338835, 18356024, 18361926, 18367112, 18381949, 18521687, 18592138, 18593902, 18617357, 18618313, 18619641, 18632220, 18663571, 18665070, 18720000, 18722373, 18722548, 18790560, 18794809, 18834948, 18927599, 18953425, 19003584, 19035518, 19039588, 19047153, 19048457, 19058305, 19083478, 19138835, 19139136, 19147569, 19176380, 19196394, 19218340, 19244345, 19277703, 19278989, 19307727, 19318580, 19329856, 19375854, 19391129, 19428370, 19445018, 19447423, 19470469, 19618291, 19621391, 19772879, 19773434, 19836060, 19845533, 19900843, 19925030, 20004133, 20027603, 20046424, 20068092, 20145019, 20145612, 20428208, 20514441, 20536410, 20558731, 20571967, 20599447, 20699280, 20717005, 20717114, 20740367, 20864511, 20876365, 20943963, 20951077, 21078168, 21187081, 21220497, 21310944, 21312242, 21375766, 21384343, 21408027, 21459756, 21476934, 21496105, 21567098, 21589857, 21668942, 21680706, 21683430, 21702037, 21763448, 21849808, 21856294, 21874258, 21907301, 21924350, 21935918, 21937212, 22037828, 22039326, 22049153, 22122764, 22218775, 22242594, 22258871, 22286316, 22329896, 22378232, 22549391, 22553222, 22575501, 22580984, 22729746, 22735610, 22829202, 22904679, 22992293, 22993369, 23013439, 23029485, 23031678, 23043547, 23053397, 23098208, 23112250, 23167360, 23180004, 23192657, 23220503, 23226427, 23371504, 23527044, 23536473, 23566419, 23567332, 23608225, 23617728, 23741059, 23800934, 23801169, 23810915, 24149137, 24171795, 24187465, 24300090, 24344016, 24345644, 24413338, 24416158, 24469308, 24533777, 24535190, 24590894, 24599585, 24616567, 24670538, 24687028, 24747121, 24763687, 24842612, 24950702, 24992958, 25060643, 25060857, 25064845, 25113252, 25131817, 25137041, 25196524, 25252849, 25310697, 25333664, 25335121, 25433169, 25449785, 25575894, 25669978, 25701047, 25797267, 25858511, 25964576, 26035123, 26159723, 26257064, 26275572, 26310524, 26359357, 26452035, 26474693, 26498686, 26577687, 26759006, 26765787, 26774881, 26823693, 26957558, 26984380, 27000374, 27074576, 27109804, 27287478, 27314294, 27388564, 27450326, 27494851, 27558792, 27628320, 27632554, 27696591, 27713126, 27835884, 27871154, 27941877, 27994517, 27999206, 28031408, 28096683, 28102676, 28150906, 28152501, 28161224, 28178650, 28260506, 28275297, 28300223, 28306608, 28346420, 28407689, 28417956, 28418604, 28430638, 28449470, 28454270, 28454432, 28458638, 28489511, 28512631, 28521457, 28567040, 28604419, 28692590, 28729694, 28732079, 28789345, 28789387, 28800785, 28807001, 28808873, 28837884, 28855534, 28927045, 28978083, 29049411, 29113232, 29140138, 29238224, 29254791, 29257333, 29290789, 29297092, 29341436, 29377693, 29404887, 29429545, 29482584, 29491072, 29492204, 29505957, 29520973, 29559247, 29562216, 29568008, 29568362, 29587478, 29610553, 29631612, 29769213, 29775390, 29782360, 29794562, 29864910, 29893307, 30003391, 30003735, 30034467, 30082142, 30106414, 30223141, 30318012, 30341914, 30384258, 30402808, 30408225, 30484108, 30567534, 30638861, 30641217, 30650553, 30651530, 30674365, 30700940, 30702971, 30715649, 30740911, 30826660, 30941311, 30941969, 31063976, 31092422, 31110179, 31113465, 31114336, 31147469, 31179232, 31222746, 31223291, 31291992, 31355777, 31366361, 31562254, 31614548, 31623608, 31632572, 31641036, 31655104, 31683257, 31692172, 31761163, 31822119, 7926468, 8566864, 9151799, 9230197, 9515807, 9521170, 9731479, 9850081, 9927047		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	20155627		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	23250387		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	10959556		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15526363, 16618763, 28254151		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	21431899, 22640700		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	36690661	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29187369, 31416888		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	34873575	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	CTD_human_DG	10698006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	30396759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurilemmoma	Neurilemmoma	BEFREE	29416648		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11032891, 15950779, 16001969, 17204142, 20851755, 21268077, 24621265, 25266063, 28671636, 29498006, 29944913, 30883354, 9726429		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11032891, 16001969, 21268077, 22276108	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31854058	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16989810, 28232747, 29663741, 29968808, 31598112, 9726429		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	LHGDN	11911965		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	29416648, 31291992		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	31291992	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24516579	Associate	★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18988310		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10815926, 11062695, 11320076, 11555578, 11850726, 11882767, 11895880, 14597555, 14604894, 14744769, 14967078, 15068324, 15374938, 15374967, 15704107, 15777970, 15825163, 16376453, 16397226, 16452236, 16707460, 16740761, 16786043, 16983095, 17237818, 17611676, 17697767, 17948911, 18381949, 18957720, 19138967, 19157634, 19217709, 19238334, 19409031, 19628293, 20047843, 20145019, 20234816, 20332326, 21385353, 21388528, 21507199, 21523772, 21565488, 23065687, 23172668, 23371504, 23620771, 24344016, 24401319, 24958470, 25113252, 25131817, 25137041, 25252849, 25338928, 25449785, 25817787, 25975224, 26033830, 26045835, 26464643, 26774881, 28489511, 28789387, 28800793, 28837884, 28883751, 29140138, 29440919, 29982425, 30122902, 30798928, 31115011, 31134158, 31440159, 31613929, 31665187, 9515807		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	17550984		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	11912139, 14735188, 15753376, 20028875, 20179229, 23216814, 24874483, 31206365		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	12750248		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	22170686		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11444591, 26920155, 29321183, 29764739, 29773671, 30232001, 31247902		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18350611, 26482123, 28676625, 29132311, 35650335, 35937803, 37252693, 37878496	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	21156398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29546532	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
oligodendroglioma	Oligodendroglioma	BEFREE	14508834		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	15484698		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	18234542, 23250779, 26369479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	23250779	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	11840453, 15922185, 16427328, 18547825, 18668543, 22294637, 23611898, 24825461, 26191174, 26505439, 27271770, 27388528, 27515563, 31146598, 33953899, 37548663, 38401067, 9077531	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	15457451, 34547432	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	21963554	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	18471798, 28431586, 39809203	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	18471798, 20378913, 28546767, 29453810, 30205824, 30585984, 31728369		★☆☆☆☆ Found in Text Mining only
Osteoarthropathy, Primary Hypertrophic	Pachydermoperiostosis syndrome	BEFREE	31063976		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	19331686		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	38287843	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	28682162		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29061958, 29571257		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36626454	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12024286, 16289620, 16818639, 16956425, 18078766, 20876365, 20926002, 21236332, 21375766, 21874258, 22922684, 26476537, 28053596, 29884091, 30761249, 31485669, 9661070		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17536311, 18797196		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19326179, 21375766, 26476537, 31485669	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	14999227, 15870720		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	14647459, 14719060, 14729623, 15269139, 18090132, 20559705, 23978451		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28438620		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	LHGDN	14747187		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	18053993	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	18053993, 18367179	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22246450	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	18166186		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11489832, 12469191, 12615701, 14633672, 15266333, 15781636, 15963707, 16044148, 18306389, 18362203, 18798061, 19621391, 21756326, 23978451, 24718658, 25335121, 28599493, 29152148, 29932878, 30647111, 31822119		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11972392, 15838264, 16044148, 16515599, 17341442, 18171606		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11891188, 12181243, 14508829, 15266333, 16328030, 16612714, 17341442, 18306389, 18362203, 19116446, 20559705, 21972293, 22689176, 23962610, 32253841, 39954656	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	14508829		★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	17645803		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29201221		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10070951, 10485483, 10657949, 10953335, 11781662, 12504222, 12533667, 14517802, 14656949, 15492268, 15542781, 16083499, 16373709, 16481301, 16807445, 17131340, 17172427, 17369849, 17652141, 17921715, 17950526, 18437081, 18665070, 19422084, 21343834, 21408027, 21655952, 21705955, 22039326, 22200969, 22829202, 22898640, 23924856, 24146280, 24520096, 24912820, 24969885, 25152585, 25497868, 26035123, 26691217, 27368132, 28260499, 28352075, 28815606, 29565462, 29896263, 29963167, 30333153, 31355777		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	31009406		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	31009406	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22503318, 26675757, 28222855, 31186753		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	10485483, 10657949, 15705899, 16820089		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	12533667, 30254182		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12533667, 12821125, 16083499		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15222037, 15476283, 16319525, 16467169, 17201164, 17950526, 18571585, 20397266, 22039326, 24912820, 24950702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15685834, 26247532	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	19820421, 28697127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	CTD_human_DG	19820421		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	23090667	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis, Chronic	Pancreatitis	LHGDN	12131767		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30431318		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15475935, 15817909, 16728574, 19391129, 20640858, 23617728, 24670538, 26511970, 28521457		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	CTD_human_DG	12151359, 16144915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	LHGDN	17592548		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	Pubtator	17592548, 20131316	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	BEFREE	20599447, 24469308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma, Squamous Cell	Papilloma	CTD_human_DG	12151359, 16144915		★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	CTD_human_DG	12151359, 16144915		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	31142060		★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	29982796		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	29483289		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17171651, 22385680, 23695225, 24360742, 26722563, 29169114, 29217173, 29498006, 30236122		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	17171651, 17560944		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26722563, 31823283, 38027039	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	19158357		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	28290146		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	26675757, 30333153		★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	25048443	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	19056808		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	19056808	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	16550596, 17581270, 18349295, 21451212		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18330937, 18381949, 30366771		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	CTD_human_DG	20801906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontal Diseases	Periodontal Diseases	BEFREE	10769133, 11850029, 24551049, 28736819, 9660336		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	20042743, 22324469, 23095809, 26743292, 39337647	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	22828789	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	12892443, 18173398, 20177132, 21047437, 22819245, 24267395, 24528298, 24695999, 26334995, 29287688, 29571257, 30450635, 31788052		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21047437, 25483140, 26334995, 34958064, 38206700	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26743292, 34213019	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	19706240	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	26498853		★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	11271370		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33655604	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18988310		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	12218179, 12650805, 12912958, 14623934, 15480979		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31142060		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	12767095, 22460097	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	15067173		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	27799459		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30662341		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30671914		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25626972, 28093231, 31770100		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28004769	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	15301234		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	12394442, 15930344, 16775170, 9809998, 9831333		★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	17942926		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29393449		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16331303		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	11584358		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	17671709		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11584358, 23900502		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	22580984		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10931458, 11289153, 11571629, 11751373, 11913955, 12386924, 14613585, 14754878, 15240520, 15287094, 15374967, 15455372, 15550400, 15878913, 15930345, 16489065, 16506214, 16585199, 16731743, 16954428, 16956712, 17066444, 17265445, 17434257, 17609663, 17695530, 17764114, 17911400, 17998819, 17999989, 18030357, 18089846, 18242387, 18645679, 18973191, 18974063, 19318492, 19488068, 19772879, 19776642, 19836060, 19965896, 20388081, 20431935, 21273602, 21308720, 21430074, 21745389, 22023987, 22435969, 22763881, 22782583, 23053989, 23646189, 24155892, 24203817, 24324057, 24324075, 24802614, 25446255, 26535654, 26788504, 26920155, 27232854, 27480340, 27647999, 28368394, 28450158, 28567040, 28941222, 29088783, 29242151, 29599304, 29765153, 30098292, 30367494, 30673592, 31157709, 31626054, 31816863, 9766645		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	30348691	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	17265445, 19038466		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	10753955, 14754878, 15126378, 16506214, 17609663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11442675, 14613585, 15550400, 15963122, 16123581, 17609663, 17998819, 18645679, 19127598, 19139136, 19318492, 19720908, 21694441, 21745389, 21786090, 24203817, 25305352, 27115470, 27140699, 27647999, 30098292, 31115550, 33623038, 33780364, 36623397	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11913955, 11959891, 14754878, 15550400, 15867220, 16506214, 17434257, 17609663, 17999989, 18512730, 18974063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16818637, 18974063, 21273602, 22023987, 29765153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21430300	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	12783173, 19318492, 19776642, 30892130, 31376214		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	15882262	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	BEFREE	15017587		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29201221		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31480263, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	22219642, 26903201, 29285278		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23681850		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19897740	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20724130, 30034228, 31419078, 35637927	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11290559, 17496151, 21681100, 23755232, 26744410, 30784938, 31646730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	26744410	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	22907529		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	17308999, 23787217, 23801169, 24022467, 28601236, 29158365		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	18392637		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	24388097		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28155120		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	14712483, 15569051		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14719128, 15049901, 15538221, 15569051, 17451187, 18976937, 25275044, 25973014, 27926489, 28155120, 31423209		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31500176		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	20471507, 28274925, 29676940		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26685098		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28356130, 28794232		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21391979, 28583479	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	26685098		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	15544519, 26822858, 29158916		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11959394, 15709205		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	19925514	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	16820901		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12024286, 15120641, 21874258		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10708568, 10812057, 12794822, 15170913, 15256475, 16821264, 17786275, 18381795, 19680656, 19846884, 20887233, 21068383, 21360527, 21655952, 22114888, 22592909, 22990668, 23872401, 23934131, 26130073, 26166764, 26505439, 28165872, 28288820, 28708839, 28863826, 29553845, 30119183, 30143947, 30186500, 30314410, 30347274, 30718447, 31564512, 31593087, 31666999, 31747811, 8132748, 9433877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	11978490, 19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17968936		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	12469937		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	16139560		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	16840740, 18514098, 19042116, 21681100, 27188849		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	LHGDN	16840740, 18514098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	19042116	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	12024286, 21874258, 30502795		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16080510	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18705402		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	17868457, 20169190, 24244164	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	16080510	Associate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	12664575		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37629065	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15041036, 15519500, 19560328, 22397921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15041036, 15276698		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15041036, 15519500, 19560328, 22397921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	37903861	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	11469463		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21769840, 26744410, 36389675	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	20346139	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	15908664, 27074568		★☆☆☆☆ Found in Text Mining only
Secondary Open Angle Glaucoma	Open Angle Glaucoma	CTD_human_DG	16330497		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	29416648		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	23463959	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10766854, 21967897, 29243040, 29782861, 30326393, 31070531		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	23608225		★☆☆☆☆ Found in Text Mining only
SHWACHMAN-DIAMOND SYNDROME 1	Shwachman-Diamond Syndrome	BEFREE	15368588		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	18758643	Associate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	16185283, 17578436, 21760883, 21995456, 22159575, 25616102		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22038215	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	22667343	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin lesion	Skin Lesion	BEFREE	28966510, 31675116		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	11980643, 20599447, 24345644, 24469308, 25575894, 28724634, 31571864, 9635856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	12164941, 22667343	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	17499752, 19748995, 21159610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	LHGDN	17578436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	18413499, 28676625, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	25873764, 28300223		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28300223, 28676625		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	30862036	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11062695, 11895880, 27765529, 28285696, 9823297		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27765529	Associate	★☆☆☆☆ Found in Text Mining only
Spastic cerebral palsy	Spastic Cerebral Palsy	BEFREE	29257210		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	11238034	Stimulate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	28349254		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	21933591		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	22730036	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27331400		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	31306980		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38019769	Stimulate	★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	15127973		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10417761, 10778945, 11344234, 11920472, 12121007, 12164941, 12174888, 12445196, 12459168, 12698187, 12875991, 12893070, 12957358, 14976535, 15068324, 15151617, 15238218, 15259059, 15704107, 16035618, 16185283, 16219633, 16908593, 18202791, 18234542, 18922923, 19074839, 19229701, 19278989, 19391123, 19630103, 20121928, 20514441, 20620096, 21923838, 22159575, 22735610, 24345644, 24371223, 24469308, 24771596, 25575894, 26009874, 26022894, 26369479, 26577687, 27577989, 27628320, 27941877, 28230039, 28724634, 30248985, 30270026, 30674365, 31480608, 31601050, 9247974, 9635856, 9823297		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11920472, 12174888, 12459168, 12875991, 12883661, 12954496, 14871981, 14989896, 15151617, 15151619, 15599594, 15645120, 15756444, 15856454, 16035618, 16908593, 17460548, 17511025, 17553653, 17624243, 18027256, 18284542, 18922923, 19074839, 19278989		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	16543248, 18202791		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10778945, 12957358, 12963227, 15151617, 15259059, 16083713, 17460548, 17511025, 18197933, 18632220, 18717758, 19082515, 19347867, 19428370, 19463183, 19538012, 19623651, 21166741, 21304218, 22147962, 22435505, 23393346, 24284961, 24535229, 24641411, 25405520, 25422234, 26323923, 26530100, 26556718, 26959737, 27456944, 27868288, 28454432, 28560067, 28888039, 30339710		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	15756444, 16543248, 18197933		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11953864, 15272284, 15461861, 18225538, 19074839, 19241124, 19300368, 20558731, 20592893, 24887090, 25579548, 25962348, 26218314, 27941877, 30900666, 32338278	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19737986	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29512696		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	15014019		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	10797288, 17578436, 23261444, 29904102, 30523664		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10070952, 12174888, 12393863, 14566822, 15287038, 15814624, 16144930, 16273222, 16533782, 17875728, 19074839, 19123475, 19391123, 19789323, 20034753, 20222044, 20592893, 20717005, 20951077, 21177768, 21301321, 21656078, 24692703, 24887090, 26568042, 27412115, 27696591, 31244433		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	12969226		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	11823979		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24887090, 27614428		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	17650224		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18988310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	28987270, 29171003, 29380527, 30195730, 30781501		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18988310		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25422106, 25451254, 29515134, 31222118, 31247902, 31282064		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	30112729		★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	25218594		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10404093, 11192946, 11223821, 11310828, 11346869, 11403917, 11535962, 11606854, 12203123, 12532440, 12532441, 12606945, 12684668, 12695555, 12746473, 12781040, 12883469, 14532971, 14962510, 15245777, 15334675, 15692787, 15864753, 15890232, 15914275, 15929174, 16082585, 16097070, 16101131, 16243808, 16260857, 16339564, 16762620, 17971584, 17982644, 18068001, 18311113, 18373164, 18611916, 18618313, 18985541, 19196394, 19201083, 19463183, 19491270, 19661089, 19940363, 20364406, 20649594, 20653782, 21086572, 21266034, 21275453, 21494638, 21538574, 21649724, 21976141, 22385256, 23001726, 23013439, 23670240, 23775011, 24023834, 24127267, 24533777, 24761915, 24935598, 25038797, 25228975, 26067133, 26391267, 26514342, 26674784, 27020655, 27079437, 27314294, 27352184, 28405152, 28624843, 29151957, 29190954, 29358963, 29434905, 29616098, 29767663, 30003735, 30391440, 30941969, 31045826, 31473273, 31491956, 31518663, 31534549, 31632572, 31792089, 9786845, 9872498		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	10980112, 31482734, 32603043	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	20388956		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	10404093, 17003101, 17224647, 22385256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	11176123, 11310828, 11854904, 12085263, 12324457, 12532440, 12532441, 12674216, 12679908, 12854133, 15754411, 15793875, 15929167, 15929174, 16097070, 16097073, 16101131, 16371352, 16769709, 17043422, 17171787, 17224647, 17659693, 17934641, 18758643, 19108014, 19463183, 19661089, 19846662, 20237896, 20977754, 21272377, 21494638, 22371637, 22901225, 23161322, 24115825, 24616567, 24761915, 25339021, 25916550, 25921160, 27198692, 27314294, 27342370, 27457107, 28624843, 29038542, 30003735, 30941969, 31491956, 32603043, 33440718, 34122616, 35938505, 36702852, 9786845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12452062, 12532440, 12684668, 12767510, 14716842, 15929174, 16097070, 16101131, 16243808, 16338068, 16371352, 16474375, 16699947, 17982644, 18181047, 18311113, 18373164, 18462890, 18775915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	14962510		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34888378	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	17495879, 21236709, 21424029	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31749137		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	24149137	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	21874258		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	10559138	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11469463, 21769840, 26744410		★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	30188221		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12470662, 20582552, 30272315, 31375151		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30530228		★☆☆☆☆ Found in Text Mining only
Testotoxicosis	Testotoxicosis	CTD_human_DG	21402727		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19887674	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29384693	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymic Carcinoma	Thymic Carcinoma	BEFREE	16823844		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	16823844, 29966585		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	LHGDN	16823844		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	CTD_human_DG	17614770		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25342622		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	16831027	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15475935, 17179688, 24670538, 33327467	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26511970	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11788675, 15947945, 16362262, 28521457, 31113465, 31113934		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	22387750		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	18362501		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	26498465	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	15817909, 15947945, 16362262		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	22387750		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11788675, 11939728, 31113465, 31113934		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15817909, 15870511		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	22387750		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17179688, 22577338, 29306248, 30140269, 31113465	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Nodule	Thyroid Nodule	BEFREE	11788675, 15879365		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	17179688	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	CTD_human_DG	16543248, 22561872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tonic - clonic seizures	Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	22123288		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	21236709		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	10880372, 20582552, 21790228, 30272315, 31179232		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	31454071		★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Insufficiency	Tricuspid Valve Insufficiency	BEFREE	26337933		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19758440, 25068292, 28054666, 37540709, 40253988	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24965402	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28054666, 29087320, 29596308, 31705927		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	28123555		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	25347447, 29384235, 30303592		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	38378964	Inhibit	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	16551850		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10980113, 18819034, 19617644, 20027603, 20160714, 20547854, 20803508, 22039321, 23529322, 25666316, 25827810, 28260017, 28420140, 28446747, 29080614, 29620794, 30082707, 30190207, 30489199, 9679035		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	16273614		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10485483		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	15947945		★☆☆☆☆ Found in Text Mining only
Unilateral agenesis of kidney	Renal aplasia	BEFREE	31838197		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	19356723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20034614, 21168919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	21168919, 31214060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10880372, 11238034, 18449376, 20423998, 21790228, 23126361, 33238953	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	10880372		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	16361798		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	17291249, 18559542, 40156395	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	27292107	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	14977838, 17671679		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11344234, 26257474, 27292107	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17291249, 19596931, 19949677, 20192574, 20686383, 29279587	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	16390782	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	24471989	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22553222, 27799459, 29901153		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	38239300	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19432844, 20209608	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28420140, 29765489		★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	15191401		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	11005841, 14642682, 19706240, 35245485	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12215479, 20424334		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	35607962	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	25400168		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	14518562		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29408903		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19004621, 21625016, 29094684		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	21625016, 23555779, 29094684, 33790887	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19004621, 21625016, 29094684		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	11772947		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	14508834		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	19157443	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	29697282		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	10651981		★☆☆☆☆ Found in Text Mining only