Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5742
Gene name	Prostaglandin-endoperoxide synthase 1
Gene symbol	PTGS1
Synonyms (NCBI Gene)	COX1COX3PCOX1PES-1PGG/HSPGHS-1PGHS1PHS1PTGHS
Chromosome	9
Chromosome location	9q33.2
Summary	This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Bas

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs10306114	A>G	Drug-response	Genic upstream transcript variant, 5 prime UTR variant, upstream transcript variant

230

Show/Hide all (230)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023020	hsa-miR-124-3p	Microarray	18668037
MIRT040875	hsa-miR-18a-3p	CLASH	23622248
MIRT717703	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT717702	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT717701	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT717700	hsa-miR-4319	HITS-CLIP	19536157
MIRT717699	hsa-miR-4324	HITS-CLIP	19536157
MIRT717698	hsa-miR-1913	HITS-CLIP	19536157
MIRT717697	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT040875	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT717696	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT717695	hsa-miR-4721	HITS-CLIP	19536157
MIRT717694	hsa-miR-7976	HITS-CLIP	19536157
MIRT717693	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT717692	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT717691	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT717690	hsa-miR-626	HITS-CLIP	19536157
MIRT717689	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT717688	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT717687	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT717686	hsa-miR-4675	HITS-CLIP	19536157
MIRT717685	hsa-miR-4741	HITS-CLIP	19536157
MIRT717684	hsa-miR-346	HITS-CLIP	19536157
MIRT717683	hsa-miR-7847-3p	HITS-CLIP	19536157
MIRT717682	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT717681	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT717680	hsa-miR-4288	HITS-CLIP	19536157
MIRT717679	hsa-miR-632	HITS-CLIP	19536157
MIRT495089	hsa-miR-3651	PAR-CLIP	22291592
MIRT495088	hsa-miR-7153-5p	PAR-CLIP	22291592
MIRT495089	hsa-miR-3651	PAR-CLIP	23708386
MIRT495088	hsa-miR-7153-5p	PAR-CLIP	23708386
MIRT733998	hsa-miR-512-3p	Luciferase reporter assayqRT-PCRWestern blotting	32678165
MIRT717703	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT717702	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT717701	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT717700	hsa-miR-4319	HITS-CLIP	19536157
MIRT717699	hsa-miR-4324	HITS-CLIP	19536157
MIRT717698	hsa-miR-1913	HITS-CLIP	19536157
MIRT717697	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT040875	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT717696	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT717695	hsa-miR-4721	HITS-CLIP	19536157
MIRT717694	hsa-miR-7976	HITS-CLIP	19536157
MIRT717693	hsa-miR-3173-5p	HITS-CLIP	19536157
MIRT717692	hsa-miR-6799-3p	HITS-CLIP	19536157
MIRT717691	hsa-miR-146b-3p	HITS-CLIP	19536157
MIRT717690	hsa-miR-626	HITS-CLIP	19536157
MIRT717689	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT717688	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT717687	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT717686	hsa-miR-4675	HITS-CLIP	19536157
MIRT717685	hsa-miR-4741	HITS-CLIP	19536157
MIRT717684	hsa-miR-346	HITS-CLIP	19536157
MIRT717683	hsa-miR-7847-3p	HITS-CLIP	19536157
MIRT717682	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT717681	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT717680	hsa-miR-4288	HITS-CLIP	19536157
MIRT717679	hsa-miR-632	HITS-CLIP	19536157
MIRT495089	hsa-miR-3651	PAR-CLIP	22291592
MIRT495088	hsa-miR-7153-5p	PAR-CLIP	22291592
MIRT495089	hsa-miR-3651	PAR-CLIP	23708386
MIRT495088	hsa-miR-7153-5p	PAR-CLIP	23708386
MIRT1273327	hsa-miR-148a	CLIP-seq
MIRT1273328	hsa-miR-148b	CLIP-seq
MIRT1273329	hsa-miR-152	CLIP-seq
MIRT1273330	hsa-miR-3065-3p	CLIP-seq
MIRT1273331	hsa-miR-3074-5p	CLIP-seq
MIRT1273332	hsa-miR-3173-3p	CLIP-seq
MIRT1273333	hsa-miR-3194-3p	CLIP-seq
MIRT1273334	hsa-miR-338-3p	CLIP-seq
MIRT1273335	hsa-miR-339-5p	CLIP-seq
MIRT1273336	hsa-miR-370	CLIP-seq
MIRT1273337	hsa-miR-3920	CLIP-seq
MIRT1273338	hsa-miR-4264	CLIP-seq
MIRT1273339	hsa-miR-4269	CLIP-seq
MIRT1273340	hsa-miR-433	CLIP-seq
MIRT1273341	hsa-miR-4428	CLIP-seq
MIRT1273342	hsa-miR-4477b	CLIP-seq
MIRT1273343	hsa-miR-4530	CLIP-seq
MIRT1273344	hsa-miR-4690-3p	CLIP-seq
MIRT1273345	hsa-miR-4797-3p	CLIP-seq
MIRT1273346	hsa-miR-490-5p	CLIP-seq
MIRT1273347	hsa-miR-512-5p	CLIP-seq
MIRT1273348	hsa-miR-539	CLIP-seq
MIRT1273349	hsa-miR-581	CLIP-seq
MIRT1273350	hsa-miR-590-3p	CLIP-seq
MIRT1273351	hsa-miR-592	CLIP-seq
MIRT1273352	hsa-miR-597	CLIP-seq
MIRT1273353	hsa-miR-599	CLIP-seq
MIRT1273354	hsa-miR-617	CLIP-seq
MIRT1273355	hsa-miR-668	CLIP-seq
MIRT1273356	hsa-miR-874	CLIP-seq
MIRT1273357	hsa-miR-298	CLIP-seq
MIRT1273358	hsa-miR-3121-3p	CLIP-seq
MIRT1273359	hsa-miR-4524	CLIP-seq
MIRT2080401	hsa-miR-1197	CLIP-seq
MIRT2080402	hsa-miR-2276	CLIP-seq
MIRT2080403	hsa-miR-33a	CLIP-seq
MIRT2080404	hsa-miR-33b	CLIP-seq
MIRT2080405	hsa-miR-3622a-5p	CLIP-seq
MIRT1273338	hsa-miR-4264	CLIP-seq
MIRT2080406	hsa-miR-4423-3p	CLIP-seq
MIRT2080407	hsa-miR-4436a	CLIP-seq
MIRT2080408	hsa-miR-4696	CLIP-seq
MIRT2080409	hsa-miR-4700-3p	CLIP-seq
MIRT2080410	hsa-miR-4731-3p	CLIP-seq
MIRT1273345	hsa-miR-4797-3p	CLIP-seq
MIRT2080411	hsa-miR-4801	CLIP-seq
MIRT2080412	hsa-miR-645	CLIP-seq
MIRT1273327	hsa-miR-148a	CLIP-seq
MIRT1273328	hsa-miR-148b	CLIP-seq
MIRT1273329	hsa-miR-152	CLIP-seq
MIRT2306567	hsa-miR-30a	CLIP-seq
MIRT2306568	hsa-miR-30b	CLIP-seq
MIRT2306569	hsa-miR-30c	CLIP-seq
MIRT2306570	hsa-miR-30d	CLIP-seq
MIRT2306571	hsa-miR-30e	CLIP-seq
MIRT2306572	hsa-miR-3671	CLIP-seq
MIRT1273337	hsa-miR-3920	CLIP-seq
MIRT2306573	hsa-miR-412	CLIP-seq
MIRT1273338	hsa-miR-4264	CLIP-seq
MIRT1273339	hsa-miR-4269	CLIP-seq
MIRT2306574	hsa-miR-4290	CLIP-seq
MIRT2306575	hsa-miR-4291	CLIP-seq
MIRT2306576	hsa-miR-4420	CLIP-seq
MIRT2306577	hsa-miR-4436b-3p	CLIP-seq
MIRT2306578	hsa-miR-4695-3p	CLIP-seq
MIRT2080409	hsa-miR-4700-3p	CLIP-seq
MIRT2306579	hsa-miR-4762-5p	CLIP-seq
MIRT1273345	hsa-miR-4797-3p	CLIP-seq
MIRT1273347	hsa-miR-512-5p	CLIP-seq
MIRT2306580	hsa-miR-607	CLIP-seq
MIRT2306581	hsa-miR-622	CLIP-seq
MIRT2306582	hsa-miR-873	CLIP-seq
MIRT2604189	hsa-miR-1	CLIP-seq
MIRT2604190	hsa-miR-1179	CLIP-seq
MIRT2604191	hsa-miR-1208	CLIP-seq
MIRT2604192	hsa-miR-1299	CLIP-seq
MIRT2604193	hsa-miR-1323	CLIP-seq
MIRT2604194	hsa-miR-146a	CLIP-seq
MIRT2604195	hsa-miR-146b-5p	CLIP-seq
MIRT2604196	hsa-miR-206	CLIP-seq
MIRT2604197	hsa-miR-3122	CLIP-seq
MIRT2604198	hsa-miR-3128	CLIP-seq
MIRT2604199	hsa-miR-3130-5p	CLIP-seq
MIRT2604200	hsa-miR-3157-5p	CLIP-seq
MIRT2604201	hsa-miR-3179	CLIP-seq
MIRT2604202	hsa-miR-3193	CLIP-seq
MIRT2604203	hsa-miR-323b-5p	CLIP-seq
MIRT2604204	hsa-miR-335	CLIP-seq
MIRT2604205	hsa-miR-3673	CLIP-seq
MIRT2604206	hsa-miR-378	CLIP-seq
MIRT2604207	hsa-miR-378b	CLIP-seq
MIRT2604208	hsa-miR-378c	CLIP-seq
MIRT2604209	hsa-miR-378d	CLIP-seq
MIRT2604210	hsa-miR-378e	CLIP-seq
MIRT2604211	hsa-miR-378f	CLIP-seq
MIRT2604212	hsa-miR-378h	CLIP-seq
MIRT2604213	hsa-miR-378i	CLIP-seq
MIRT2604214	hsa-miR-3913-5p	CLIP-seq
MIRT2604215	hsa-miR-422a	CLIP-seq
MIRT2604216	hsa-miR-4252	CLIP-seq
MIRT2306575	hsa-miR-4291	CLIP-seq
MIRT2604217	hsa-miR-4310	CLIP-seq
MIRT2604218	hsa-miR-4482	CLIP-seq
MIRT2604219	hsa-miR-450b-3p	CLIP-seq
MIRT2604220	hsa-miR-4511	CLIP-seq
MIRT2604221	hsa-miR-4520a-5p	CLIP-seq
MIRT2604222	hsa-miR-4520b-5p	CLIP-seq
MIRT2604223	hsa-miR-4638-3p	CLIP-seq
MIRT2604224	hsa-miR-4691-3p	CLIP-seq
MIRT2604225	hsa-miR-4714-5p	CLIP-seq
MIRT2604226	hsa-miR-4720-5p	CLIP-seq
MIRT2604227	hsa-miR-4778-5p	CLIP-seq
MIRT2604228	hsa-miR-4782-5p	CLIP-seq
MIRT2604229	hsa-miR-4799-3p	CLIP-seq
MIRT2604230	hsa-miR-483-3p	CLIP-seq
MIRT2604231	hsa-miR-505	CLIP-seq
MIRT2604232	hsa-miR-508-5p	CLIP-seq
MIRT1273347	hsa-miR-512-5p	CLIP-seq
MIRT2604233	hsa-miR-516b	CLIP-seq
MIRT2604234	hsa-miR-548aa	CLIP-seq
MIRT2604235	hsa-miR-548b-3p	CLIP-seq
MIRT2604236	hsa-miR-548o	CLIP-seq
MIRT2604237	hsa-miR-589	CLIP-seq
MIRT2604238	hsa-miR-596	CLIP-seq
MIRT2604239	hsa-miR-613	CLIP-seq
MIRT2604240	hsa-miR-630	CLIP-seq
MIRT2604241	hsa-miR-665	CLIP-seq
MIRT2604242	hsa-miR-769-3p	CLIP-seq
MIRT2306582	hsa-miR-873	CLIP-seq
MIRT2604243	hsa-miR-875-3p	CLIP-seq
MIRT2604189	hsa-miR-1	CLIP-seq
MIRT2604190	hsa-miR-1179	CLIP-seq
MIRT2604191	hsa-miR-1208	CLIP-seq
MIRT2604192	hsa-miR-1299	CLIP-seq
MIRT2604194	hsa-miR-146a	CLIP-seq
MIRT2604195	hsa-miR-146b-5p	CLIP-seq
MIRT2604196	hsa-miR-206	CLIP-seq
MIRT2604197	hsa-miR-3122	CLIP-seq
MIRT2604198	hsa-miR-3128	CLIP-seq
MIRT2604199	hsa-miR-3130-5p	CLIP-seq
MIRT2604200	hsa-miR-3157-5p	CLIP-seq
MIRT2604201	hsa-miR-3179	CLIP-seq
MIRT2604203	hsa-miR-323b-5p	CLIP-seq
MIRT2604205	hsa-miR-3673	CLIP-seq
MIRT2604214	hsa-miR-3913-5p	CLIP-seq
MIRT2604216	hsa-miR-4252	CLIP-seq
MIRT2306575	hsa-miR-4291	CLIP-seq
MIRT2604217	hsa-miR-4310	CLIP-seq
MIRT2604218	hsa-miR-4482	CLIP-seq
MIRT2604219	hsa-miR-450b-3p	CLIP-seq
MIRT2604220	hsa-miR-4511	CLIP-seq
MIRT2604224	hsa-miR-4691-3p	CLIP-seq
MIRT2604226	hsa-miR-4720-5p	CLIP-seq
MIRT2604227	hsa-miR-4778-5p	CLIP-seq
MIRT2604228	hsa-miR-4782-5p	CLIP-seq
MIRT2604229	hsa-miR-4799-3p	CLIP-seq
MIRT2604230	hsa-miR-483-3p	CLIP-seq
MIRT2604231	hsa-miR-505	CLIP-seq
MIRT2604233	hsa-miR-516b	CLIP-seq
MIRT2604235	hsa-miR-548b-3p	CLIP-seq
MIRT2604237	hsa-miR-589	CLIP-seq
MIRT2604239	hsa-miR-613	CLIP-seq
MIRT2604240	hsa-miR-630	CLIP-seq
MIRT2689052	hsa-miR-7	CLIP-seq
MIRT2604242	hsa-miR-769-3p	CLIP-seq
MIRT2306582	hsa-miR-873	CLIP-seq
MIRT2604243	hsa-miR-875-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
KLF10	Activation	23178857

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	ISS
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0004601	Function	Peroxidase activity	IEA
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IBA
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IDA	1380156
GO:0004666	Function	Prostaglandin-endoperoxide synthase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12355421
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA
GO:0019371	Process	Cyclooxygenase pathway	IBA
GO:0019371	Process	Cyclooxygenase pathway	IDA	1380156
GO:0019371	Process	Cyclooxygenase pathway	IEA
GO:0020037	Function	Heme binding	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	18570454
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
176805	9604	ENSG00000095303

P23219

Protein name

Prostaglandin G/H synthase 1 (EC 1.14.99.1) (Cyclooxygenase-1) (COX-1) (Prostaglandin H2 synthase 1) (PGH synthase 1) (PGHS-1) (PHS 1) (Prostaglandin-endoperoxide synthase 1)

Protein function

Dual cyclooxygenase and peroxidase that plays an important role in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate, AA, C20:4(n-6)), with a particular role in

PDB

6Y3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	33 → 67	EGF-like domain	Domain
PF03098	An_peroxidase	213 → 576	Animal haem peroxidase	Domain

Sequence

MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

Sequence length

599

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways Platelet activation Serotonergic synapse Regulation of lipolysis in adipocytes		COX reactions Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (36)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemorrhage	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL POLYPS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CYSTS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLATELET-TYPE BLEEDING DISORDER 12	—	ClinGen, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PTGS1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP DEPRIVATION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (266)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19485927, 30654930, 31828756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15190260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	15190260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11059772, 11809691, 11920472, 8566864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11920472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11005569, 15585388, 15958546, 17691999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11584208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15159324, 17640058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15807932, 19205707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11685545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	15301234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22832605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36042609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23083210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12189197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17495879, 23060635, 29216624, 29375570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20656922, 25893742, 9433877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10719816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33707464	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	9433877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	9433877, 9714356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16055872, 17508966, 17622692, 24948368, 25721048, 28286156, 29249187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18753249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23441755, 25721048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	CTD_human_DG	25721048		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	17508966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17495879, 23060635, 29216624, 29375570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34905596, 36690661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29161772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	15585388, 17405999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29102659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11342898, 12352459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	31628732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24989010, 27629384, 28300459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10571077, 11897504, 19276290, 29492489, 31064095, 9521170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18488158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10571077, 33800915	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	17508966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchospasm	Bronchospasm	BEFREE	29883727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	15726092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10880372, 11809691, 11827414, 16362262, 9823297		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12189197		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27965980	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31215439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11342898, 11827414, 12352459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11920472, 30114468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19271346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23886173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11809691	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28886030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10417761, 16596229, 20051366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12615701, 15963707, 18090132, 23978451, 28599493, 29727350, 31172046, 31229884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12189197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10942685, 17495879, 19091535, 23038044, 27566955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17495879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17495879, 26870959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23765972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31735164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26781425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	31735164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	27738873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15041270, 17495879, 19390185, 24930730, 28431615, 28703413		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12821346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11809691, 12821346, 19399588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19056482, 19282863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15127973, 9603116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28286156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	27538737, 29249187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30476507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28432343, 31248980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17653443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10931458, 16091009, 20043083, 24022467, 27566955, 27998883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16115753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	37756582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11062695, 12353842, 14965325, 15075004, 18992148, 21351261, 21976545, 23222413, 24171795, 28139830, 29421522, 30320345, 30580092, 31734182, 7926468, 8566864, 9589912 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12734198, 15328521, 18992148, 21976545, 31734182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	15075004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15328521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18992148	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital lactic acidosis	Congenital lactic acidosis	BEFREE	22243966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20304815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23886173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16493486, 16702043, 21434767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16493486, 16702043, 21434767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24699314, 34905596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16493486, 16702043, 21434767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corpus Luteum Cyst	Corpus Luteum Cyst	CTD_human_DG	21239663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	12663931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19148357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	19637222, 21075201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	BEFREE	10487525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30548602, 9433877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15776109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	15301234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24136929, 30811756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24136929, 30811756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24136929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17263765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	25666316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35227068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	22243966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31420920, 9402302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18204294, 21816851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30030837, 30521407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28599493, 29727350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythromelalgia	Erythromelalgia	BEFREE	25116182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	12189197		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esophagitis	BEFREE	21451212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extravasation of Diagnostic and Therapeutic Materials	Extravasation of diagnostic and therapeutic materials	Pubtator	32678165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eyelid Xanthoma	Eyelid Xanthoma	BEFREE	28481769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	15585388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	10594344, 19066340		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	BEFREE	11136275, 27916468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric ulcer	Gastric ulcer	LHGDN	15720413, 17671743		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	LHGDN	15720413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	15585388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	11581208, 25339146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29860315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29860315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29860315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11877441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	10405195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	10405195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	15375804, 18173552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	20304815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20304815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	27629384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	27629384	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Histiocytosis	Histiocytosis	BEFREE	28481769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	7909283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	28212299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30240925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	15607906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10786968, 17641732, 19282863, 23953622, 25320332, 30108767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29860315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	15301234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28530128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15127973, 23742950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	27715371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28480270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30476507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	22747653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31248980, 9679035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insufficient Sleep Syndrome	Insufficient Sleep Syndrome	CTD_human_DG	16343605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30590313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	15041270, 19046748, 19485927, 21816595, 24930730, 31735164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	30328712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	9644630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17584101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19420110		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20304815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh syndrome , French Canadian type	Leigh syndrome	BEFREE	15139850		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15190260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17624243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16391822, 31215439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36246566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23742950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15870920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	9644630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24699314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	9644630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	9644630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	18459455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	9644630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10571077, 11897504, 19276290, 29492489, 31064095, 9521170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18488158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	12189197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	17691999, 8931116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28979299, 30114468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17624243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12615701, 15838264, 15963707, 18090132, 23978451, 31172046, 31229884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20530583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15930345, 26788504, 30312731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11192946, 11535962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11342898, 12352459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10487525, 11192946, 11208460, 11687726, 15838264, 16337272, 17604853, 20392831, 20530583, 21478098, 23967159, 28277128, 30312731, 30320345, 30597284, 31526853, 7926468 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12821346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16091009, 20043083, 20654727, 24022467, 27566955, 27998883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18488158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18488158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18488158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	LHGDN	12665651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	16997128		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10417761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15251468	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	17961045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15776109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30052978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	31542386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11535962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16385588, 26724804, 30590258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19506164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20304815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17868881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19046748, 26658659, 30108767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26658659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15301234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	10390414, 11994707, 15480320, 20034923, 30847401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23441755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10417761, 10515422, 11192946, 11370818, 11535962, 11602250, 11687726, 11827414, 11920472, 12353842, 12538661, 12615701, 12821346, 15075004, 16391822 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	10959556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	36690661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17245372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	21163656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28187366, 29771124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10515422, 11062695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31704447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15262246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33800915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18090132, 23978451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	CTD_human_DG	21239663		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	12615701, 15963707, 29482584, 31172046, 31229884		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15963707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20404564, 25972361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20530583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20530583, 24136929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	17078001, 17671743, 20586862, 25243161, 26369686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30039419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30039419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19460300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	15301234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	15159324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	28712920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostaglandin-Endoperoxide Synthase 1 Deficiency, Platelet	Bleeding Disorder	GENOMICS_ENGLAND_DG	6103258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10931458, 15455372, 15930345, 26788504, 30312731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33623038, 38087324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26748901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31480263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24022467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23886173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	10959556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	25439353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	25439353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	27297950	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10812057, 12296865, 8132748		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15167967		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	15167967		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	22397921, 28137973, 30052978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22397921		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11122255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23060635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11062695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	15127973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11809691, 11920472, 12958179, 31064095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11920472, 12954496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19082515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20034753, 21301321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11192946, 11535962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	26830988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11176123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18618313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17495879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27738873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	15262246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	19141058, 21357261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22234683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	28378909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Platelet Dysfunction Hemolysis and Imbalanced Globin Synthesis	Thrombocytopenia	Pubtator	33054111	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16362262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	7909283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	28684424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28432343, 9679035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12189197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11809691	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	BEFREE	28481769		★★★★★ ★☆☆☆☆ Found in Text Mining only

PTGS1 (prostaglandin-endoperoxide synthase 1)