RHOJ (ras homolog family member J)

Gene

• Entrez ID: 57381
• Gene name: Ras homolog family member J
• Gene symbol: RHOJ
• Synonyms (NCBI Gene): ARHJ, RASL7B, TC10B, TCL
• Chromosome: 14
• Chromosome location: 14q23.2
• Summary: This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT710897	hsa-miR-891b	HITS-CLIP	19536157
MIRT710896	hsa-miR-6847-3p	HITS-CLIP	19536157
MIRT710895	hsa-miR-3653-3p	HITS-CLIP	19536157
MIRT710894	hsa-miR-1178-3p	HITS-CLIP	19536157
MIRT1305982	hsa-miR-1264	CLIP-seq
MIRT1305983	hsa-miR-4292	CLIP-seq
MIRT1305984	hsa-miR-4308	CLIP-seq
MIRT1305985	hsa-miR-4769-3p	CLIP-seq
MIRT1305986	hsa-miR-604	CLIP-seq
MIRT1305987	hsa-miR-647	CLIP-seq
MIRT1305988	hsa-miR-942	CLIP-seq
MIRT2393722	hsa-miR-3135b	CLIP-seq
MIRT2393723	hsa-miR-3187-3p	CLIP-seq
MIRT2393724	hsa-miR-3652	CLIP-seq
MIRT2393725	hsa-miR-4430	CLIP-seq
MIRT2393726	hsa-miR-4435	CLIP-seq
MIRT2393727	hsa-miR-4453	CLIP-seq
MIRT2393728	hsa-miR-4505	CLIP-seq
MIRT2393729	hsa-miR-4538	CLIP-seq
MIRT2393730	hsa-miR-4633-3p	CLIP-seq
MIRT2393731	hsa-miR-4701-5p	CLIP-seq
MIRT2393732	hsa-miR-548s	CLIP-seq
MIRT2393733	hsa-miR-588	CLIP-seq
MIRT1305987	hsa-miR-647	CLIP-seq
MIRT2439901	hsa-miR-1245b-3p	CLIP-seq
MIRT2439902	hsa-miR-3942-3p	CLIP-seq
MIRT2439903	hsa-miR-4275	CLIP-seq
MIRT2458198	hsa-miR-1273f	CLIP-seq
MIRT2458199	hsa-miR-143	CLIP-seq
MIRT2458200	hsa-miR-3662	CLIP-seq
MIRT2458201	hsa-miR-4450	CLIP-seq
MIRT2458202	hsa-miR-4708-5p	CLIP-seq
MIRT2458203	hsa-miR-4770	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	27660391
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	NAS	10967094
GO:0005515	Function	Protein binding	IPI	25416956, 30158707, 31515488, 32296183, 32814053, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	27660391
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	27660391, 30158707
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006897	Process	Endocytosis	IBA
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0010594	Process	Regulation of endothelial cell migration	IMP	30158707
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	10967094
GO:0061299	Process	Retina vasculature morphogenesis in camera-type eye	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	28727754
GO:1903670	Process	Regulation of sprouting angiogenesis	IMP	21628409, 30158707

Other IDs

• MIM: 607653
• HGNC: 688
• e!Ensembl: ENSG00000126785

Protein

• UniProt ID: Q9H4E5
• Protein name: Rho-related GTP-binding protein RhoJ (Ras-like protein family member 7B) (Tc10-like GTP-binding protein)
• Protein function: Plasma membrane-associated small GTPase specifically involved in angiogenesis (PubMed:21628409, PubMed:24434213, PubMed:30158707). Required for endothelial cell migration during vascular development via its interaction with GLUL (PubMed:30158707
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	23 → 196	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in endothelial cells in different tissues, such as brain, heart, lung and liver. {ECO:0000269|PubMed:21628409}.
• Sequence:

  MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAV
  TVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
  DCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQ
  KGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

• Sequence length: 214

Pathways

KEGG:

Salmonella infection

Reactome:

Rho GTPase cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28533502		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28209621, 30146770		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29310106		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	21037199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	21037199		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25137373	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25137373		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	17047090		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	9264394		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28727754		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35173528	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11272897, 28248813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30146770		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29310106		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11272897, 31638412		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22971344, 27660391, 28753606	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	21037199		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21753698, 24955145, 28750640, 29344179, 30146770		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31638412		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29924424	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	7655745		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	11272897		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11807981		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28796362		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32174791	Associate	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	26146844		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11272897, 22819381, 28248813, 28796362, 9264394		★☆☆☆☆ Found in Text Mining only