Gene Gene information from NCBI Gene database.
Entrez ID 57343
Gene name Zinc finger protein 304
Gene symbol ZNF304
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.43
Summary This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein functions as a transcriptional repressor that recruits a corepressor complex to stimulate promoter hypermethylation and transcriptional silencing of t
miRNA miRNA information provided by mirtarbase database.
411
miRTarBase ID miRNA Experiments Reference
MIRT1521686 hsa-miR-103a CLIP-seq
MIRT1521687 hsa-miR-107 CLIP-seq
MIRT1521688 hsa-miR-1185 CLIP-seq
MIRT1521689 hsa-miR-1207-3p CLIP-seq
MIRT1521690 hsa-miR-122 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 24623306
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001525 Process Angiogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613840 13505 ENSG00000131845
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HCX3
Protein name Zinc finger protein 304 (KRAB-containing zinc finger protein)
Protein function Acts as a transcriptional regulator and plays a role in gene silencing (PubMed:24623306, PubMed:26081979). Probably forms a corepressor complex required for activated KRAS-mediated promoter hypermethylation and transcriptional silencing of sever
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 13 54 KRAB box Family
PF00096 zf-C2H2 307 329 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 335 357 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 363 385 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 391 413 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 419 441 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 475 497 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 503 525 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 531 553 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 559 581 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 587 609 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 615 637 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in undifferentiated embryonic stem cells (ESCs) (PubMed:24623306). Expressed strongly in colorectal cancers cells (CRCs) (PubMed:24623306). Expressed strongly in ovarian carcinoma (OC) tumor cell lines compared to non-transfo
Sequence
MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALVATLGFWCEAE
HEAPSEQSVSVEGVSQVRTAESGLFQKAHPCEMCDPLLKDILHLAEHQGSHLTQKLCTRG
LCRRRFSFSANFYQHQKQHNGENCFRGDDGGASFVKSCTVHMLGRSFTCREEGMDLPDSS
GLFQHQTTYNRVSPCRRTECMESFPHSSSLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLD
SQMTHAEVRPFRCLPCGNVFKEKSALINHRKIHSGEISHVCKECGKAFIHLHHLKMHQKF
HTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHLVQHQRIHTGE
RPYKCNKCGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEHWRIHTGARPYE
CIECGKFFSHNSSLIKHRRVH
TGARSYVCSKCGKAFGCKDTLVQHQIIHTGARPYECSEC
GKAFSRKDTLVQHQKIH
TGERPYECGECGKFFSHSSNLIVHQRIHTGAKPYECNECGKCF
SHNSSLILHQRVH
TGARPYVCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNS
GLILHQRVH
TGEKPYVCSECGKAYSRSSHLVRHQKAHTGERAHECNSFGGPLAASLKLV
Sequence length 659
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OBSESSIVE-COMPULSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Prostate cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 30012466
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 24393480
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 24393480, 32531444, 35974349 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 30012466
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 26081979 Associate
★☆☆☆☆
Found in Text Mining only