Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57332
Gene name	Chromobox 8
Gene symbol	CBX8
Synonyms (NCBI Gene)	PC3RC1
Chromosome	17
Chromosome location	17q25.3

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT669210	hsa-miR-509-3p	HITS-CLIP	23824327
MIRT669209	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT669208	hsa-miR-505-5p	HITS-CLIP	23824327
MIRT669207	hsa-miR-6827-5p	HITS-CLIP	23824327
MIRT669206	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT669205	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT669204	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT669203	hsa-miR-2110	HITS-CLIP	23824327
MIRT669202	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT669200	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT669201	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT624434	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT624433	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT624432	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT624431	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT624430	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT624429	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT624428	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT624427	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT624426	hsa-miR-3609	HITS-CLIP	23824327
MIRT624425	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT624424	hsa-miR-4796-3p	HITS-CLIP	23824327
MIRT624420	hsa-miR-8485	HITS-CLIP	23824327
MIRT624419	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT624418	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT624417	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT624434	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT624433	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT624432	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT624431	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT624430	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT624429	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT624428	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT624427	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT624426	hsa-miR-3609	HITS-CLIP	23824327
MIRT624425	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT624424	hsa-miR-4796-3p	HITS-CLIP	23824327
MIRT624423	hsa-miR-519a-3p	HITS-CLIP	23824327
MIRT624422	hsa-miR-519b-3p	HITS-CLIP	23824327
MIRT624421	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT624420	hsa-miR-8485	HITS-CLIP	23824327
MIRT624419	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT624418	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT624417	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT440996	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440996	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT669210	hsa-miR-509-3p	HITS-CLIP	23824327
MIRT669209	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT669208	hsa-miR-505-5p	HITS-CLIP	23824327
MIRT669207	hsa-miR-6827-5p	HITS-CLIP	23824327
MIRT669206	hsa-miR-1343-5p	HITS-CLIP	23824327
MIRT669205	hsa-miR-939-5p	HITS-CLIP	23824327
MIRT669204	hsa-miR-6825-5p	HITS-CLIP	23824327
MIRT669203	hsa-miR-2110	HITS-CLIP	23824327
MIRT669202	hsa-miR-6810-5p	HITS-CLIP	23824327
MIRT669200	hsa-miR-6857-5p	HITS-CLIP	23824327
MIRT669201	hsa-miR-450a-2-3p	HITS-CLIP	23824327
MIRT624434	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT624433	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT624432	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT624431	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT624430	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT624429	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT624428	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT624427	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT624426	hsa-miR-3609	HITS-CLIP	23824327
MIRT624425	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT624424	hsa-miR-4796-3p	HITS-CLIP	23824327
MIRT624420	hsa-miR-8485	HITS-CLIP	23824327
MIRT624419	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT624418	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT624417	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT624434	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT624433	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT624432	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT624431	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT624430	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT624429	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT624428	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT624427	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT624426	hsa-miR-3609	HITS-CLIP	23824327
MIRT624425	hsa-miR-548ah-5p	HITS-CLIP	23824327
MIRT624424	hsa-miR-4796-3p	HITS-CLIP	23824327
MIRT624423	hsa-miR-519a-3p	HITS-CLIP	23824327
MIRT624422	hsa-miR-519b-3p	HITS-CLIP	23824327
MIRT624421	hsa-miR-519c-3p	HITS-CLIP	23824327
MIRT624420	hsa-miR-8485	HITS-CLIP	23824327
MIRT624419	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT624418	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT624417	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT1957284	hsa-miR-4279	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19636380, 21282530
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	19636380
GO:0000792	Component	Heterochromatin	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 17332741, 18927235, 19636380, 20543829, 20601937, 21282530, 22094252, 23260655, 24981860, 25416956, 26496610, 27505670, 27705803, 28514442, 30021884, 32296183, 33961781, 34316702
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0031519	Component	PcG protein complex	IDA	21282530
GO:0031519	Component	PcG protein complex	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IEA
GO:0035102	Component	PRC1 complex	IBA
GO:0035102	Component	PRC1 complex	IDA	12167701, 19636380
GO:0035102	Component	PRC1 complex	IEA
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0061628	Function	Histone H3K27me3 reader activity	IDA	21029866
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IEA

MIM	HGNC	e!Ensembl
617354	15962	ENSG00000141570

Q9HC52

Protein name

Chromobox protein homolog 8 (Polycomb 3 homolog) (Pc3) (hPc3) (Rectachrome 1)

Protein function

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remod

PDB

2N4Q , 3I91 , 5EQ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00385	Chromo	11 → 60	Chromo (CHRromatin Organisation MOdifier) domain	Domain
PF17218	CBX7_C	349 → 381	CBX family C-terminal motif	Motif

Sequence

MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex		Oxidative Stress Induced Senescence SUMOylation of DNA damage response and repair proteins SUMOylation of transcription cofactors SUMOylation of chromatin organization proteins SUMOylation of RNA binding proteins RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known Regulation of PTEN gene transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	15741235, 27346354, 30504704		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	33400401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30718464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31495785, 35813444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35813444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30007986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30007986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25398592, 31849331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25360999, 30383736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30383736, 31849331, 35681547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	33632238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	34580195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25197352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36221371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25839328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24260522, 35210369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35210369, 35713250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24671951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29066512, 30718464, 31495785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35681547	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15741235, 27346354, 30504704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25284287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25398592, 28837252, 31849331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30007986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25398592, 31849331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32860274	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35392614	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25197352, 29066512, 29432691, 30007986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15741235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35813444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35894945	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32366400, 37478850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	36311769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25197352, 28912889, 31255735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26837964, 34117289, 35969177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28837252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30007986, 34449496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CBX8 (chromobox 8)