PTGER3 (prostaglandin E receptor 3)

Gene

• Entrez ID: 5733
• Gene name: Prostaglandin E receptor 3
• Gene symbol: PTGER3
• Synonyms (NCBI Gene): EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3-VI, EP3e, PGE2-R, lnc003875
• Chromosome: 1
• Chromosome location: 1p31.1
• Summary: The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system,

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT528588	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT528587	hsa-miR-5695	PAR-CLIP	22012620
MIRT528586	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT528585	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT528584	hsa-miR-489-3p	PAR-CLIP	22012620
MIRT528583	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT528582	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT528581	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT445841	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT445840	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT445839	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT732988	hsa-miR-106b-5p	Microarray	33435900
MIRT528588	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT528587	hsa-miR-5695	PAR-CLIP	22012620
MIRT528586	hsa-miR-515-5p	PAR-CLIP	22012620
MIRT528585	hsa-miR-519e-5p	PAR-CLIP	22012620
MIRT528584	hsa-miR-489-3p	PAR-CLIP	22012620
MIRT528583	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT528582	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT528581	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT445841	hsa-miR-5003-3p	PAR-CLIP	22100165
MIRT445840	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT445839	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT1272629	hsa-miR-1200	CLIP-seq
MIRT1272630	hsa-miR-181a	CLIP-seq
MIRT1272631	hsa-miR-181b	CLIP-seq
MIRT1272632	hsa-miR-181c	CLIP-seq
MIRT1272633	hsa-miR-181d	CLIP-seq
MIRT1272634	hsa-miR-186	CLIP-seq
MIRT1272635	hsa-miR-208a	CLIP-seq
MIRT1272636	hsa-miR-208b	CLIP-seq
MIRT1272637	hsa-miR-3074-5p	CLIP-seq
MIRT737845	hsa-miR-3120-3p	CLIP-seq
MIRT1272638	hsa-miR-3129-3p	CLIP-seq
MIRT1272639	hsa-miR-3133	CLIP-seq
MIRT1272640	hsa-miR-3140-5p	CLIP-seq
MIRT1272641	hsa-miR-3145-3p	CLIP-seq
MIRT1272642	hsa-miR-3177-5p	CLIP-seq
MIRT1272643	hsa-miR-320a	CLIP-seq
MIRT1272644	hsa-miR-320b	CLIP-seq
MIRT1272645	hsa-miR-320c	CLIP-seq
MIRT1272646	hsa-miR-320d	CLIP-seq
MIRT1272647	hsa-miR-3617	CLIP-seq
MIRT1272648	hsa-miR-3658	CLIP-seq
MIRT737844	hsa-miR-3908	CLIP-seq
MIRT1272649	hsa-miR-3920	CLIP-seq
MIRT737842	hsa-miR-3925-5p	CLIP-seq
MIRT1272650	hsa-miR-4262	CLIP-seq
MIRT737843	hsa-miR-4311	CLIP-seq
MIRT1272651	hsa-miR-4312	CLIP-seq
MIRT1272652	hsa-miR-4429	CLIP-seq
MIRT1272653	hsa-miR-4668-3p	CLIP-seq
MIRT1272654	hsa-miR-4719	CLIP-seq
MIRT1272655	hsa-miR-4744	CLIP-seq
MIRT1272656	hsa-miR-487a	CLIP-seq
MIRT1272657	hsa-miR-488	CLIP-seq
MIRT1272658	hsa-miR-499-5p	CLIP-seq
MIRT1272659	hsa-miR-561	CLIP-seq
MIRT1272660	hsa-miR-579	CLIP-seq
MIRT1272661	hsa-miR-598	CLIP-seq
MIRT1272662	hsa-miR-641	CLIP-seq
MIRT1272663	hsa-miR-1238	CLIP-seq
MIRT1272664	hsa-miR-4272	CLIP-seq
MIRT1272653	hsa-miR-4668-3p	CLIP-seq
MIRT1272665	hsa-miR-4691-5p	CLIP-seq
MIRT1272666	hsa-miR-4698	CLIP-seq
MIRT1272667	hsa-miR-605	CLIP-seq
MIRT1552675	hsa-miR-3622b-5p	CLIP-seq
MIRT1552676	hsa-miR-4461	CLIP-seq
MIRT1921278	hsa-miR-203	CLIP-seq
MIRT1921279	hsa-miR-2681	CLIP-seq
MIRT2080159	hsa-miR-106a	CLIP-seq
MIRT2080160	hsa-miR-106b	CLIP-seq
MIRT2080161	hsa-miR-17	CLIP-seq
MIRT2080162	hsa-miR-20a	CLIP-seq
MIRT2080163	hsa-miR-20b	CLIP-seq
MIRT2080164	hsa-miR-302a	CLIP-seq
MIRT2080165	hsa-miR-302b	CLIP-seq
MIRT2080166	hsa-miR-302c	CLIP-seq
MIRT2080167	hsa-miR-302d	CLIP-seq
MIRT2080168	hsa-miR-302e	CLIP-seq
MIRT2080169	hsa-miR-3688-3p	CLIP-seq
MIRT2080170	hsa-miR-371b-5p	CLIP-seq
MIRT2080171	hsa-miR-372	CLIP-seq
MIRT2080172	hsa-miR-373	CLIP-seq
MIRT2080173	hsa-miR-3978	CLIP-seq
MIRT2080174	hsa-miR-4643	CLIP-seq
MIRT1272666	hsa-miR-4698	CLIP-seq
MIRT2080175	hsa-miR-4717-3p	CLIP-seq
MIRT2080176	hsa-miR-4802-3p	CLIP-seq
MIRT2080177	hsa-miR-519d	CLIP-seq
MIRT2080178	hsa-miR-520a-3p	CLIP-seq
MIRT2080179	hsa-miR-520b	CLIP-seq
MIRT2080180	hsa-miR-520c-3p	CLIP-seq
MIRT2080181	hsa-miR-520d-3p	CLIP-seq
MIRT2080182	hsa-miR-520e	CLIP-seq
MIRT2080183	hsa-miR-93	CLIP-seq
MIRT2306430	hsa-miR-128	CLIP-seq
MIRT1272630	hsa-miR-181a	CLIP-seq
MIRT1272631	hsa-miR-181b	CLIP-seq
MIRT1272632	hsa-miR-181c	CLIP-seq
MIRT1272633	hsa-miR-181d	CLIP-seq
MIRT1272634	hsa-miR-186	CLIP-seq
MIRT2306431	hsa-miR-27a	CLIP-seq
MIRT2306432	hsa-miR-27b	CLIP-seq
MIRT1272639	hsa-miR-3133	CLIP-seq
MIRT1272641	hsa-miR-3145-3p	CLIP-seq
MIRT2306433	hsa-miR-3149	CLIP-seq
MIRT2306434	hsa-miR-34b	CLIP-seq
MIRT1272650	hsa-miR-4262	CLIP-seq
MIRT2306435	hsa-miR-450b-5p	CLIP-seq
MIRT2306436	hsa-miR-4659a-3p	CLIP-seq
MIRT2306437	hsa-miR-4659b-3p	CLIP-seq
MIRT1272666	hsa-miR-4698	CLIP-seq
MIRT2306438	hsa-miR-4700-3p	CLIP-seq
MIRT2306439	hsa-miR-4708-5p	CLIP-seq
MIRT2306440	hsa-miR-4756-3p	CLIP-seq
MIRT2306441	hsa-miR-4760-3p	CLIP-seq
MIRT2306442	hsa-miR-507	CLIP-seq
MIRT2306443	hsa-miR-513a-5p	CLIP-seq
MIRT2306444	hsa-miR-520d-5p	CLIP-seq
MIRT2306445	hsa-miR-524-5p	CLIP-seq
MIRT2306446	hsa-miR-557	CLIP-seq
MIRT1272660	hsa-miR-579	CLIP-seq
MIRT2306447	hsa-miR-630	CLIP-seq
MIRT2306448	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004955	Function	Prostaglandin receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IBA
GO:0004957	Function	Prostaglandin E receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	NAS	9073510
GO:0004957	Function	Prostaglandin E receptor activity	TAS	10947062
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005635	Component	Nuclear envelope	TAS	10336471
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	31097585
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8307176, 10336471
GO:0006954	Process	Inflammatory response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8307176
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0008219	Process	Cell death	TAS	10947062
GO:0014827	Process	Intestine smooth muscle contraction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9073510
GO:0031622	Process	Positive regulation of fever generation	ISS
GO:0060455	Process	Negative regulation of gastric acid secretion	IBA

Other IDs

• MIM: 176806
• HGNC: 9595
• e!Ensembl: ENSG00000050628

Protein

• UniProt ID: P43115
• Protein name: Prostaglandin E2 receptor EP3 subtype (PGE receptor EP3 subtype) (PGE2 receptor EP3 subtype) (PGE2-R) (Prostanoid EP3 receptor)
• Protein function: Receptor for prostaglandin E2 (PGE2) (PubMed:7883006, PubMed:7981210, PubMed:8117308, PubMed:8135729, PubMed:8307176). The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elev
• PDB: 6AK3, 6M9T, 7WU9, 8GDC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	65 → 346	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in kidney (PubMed:8117308, PubMed:8135729). Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels. {ECO:0000269|PubMed:18023986, ECO:0000269|PubMed:8117308, ECO:0000269|PubM
• Sequence:

  MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
  TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
  EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
  VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
  ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
  MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
  RYHTNNYASSSTSLPCQCSSTLMWSDHLER

• Sequence length: 390

Pathways

KEGG:

Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Human cytomegalovirus infection
Pathways in cancer

Reactome:

Prostanoid ligand receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BENIGN MUCOUS MEMBRANE PEMPHIGOID WITH OCULAR INVOLVEMENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGOID, BENIGN MUCOUS MEMBRANE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	21589857		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11685545		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34220331	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34981809	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26632188		★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	23155414	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	30664203	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25333975		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33273889	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17496729, 20587336		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17877755		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16405508		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25333975		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	19012178	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29661238		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20503412, 33849622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32144299, 32788609	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37455526	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31485769		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28699682		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28753926		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30402741		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28753926		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27837675		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21070749		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27439062		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32971215	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	23904482		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30629897		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33435900	Associate	★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	21966456		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21589857	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26240828	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	26240828	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36524127	Associate	★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	27871023		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASDB_DG	22419738		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19562039	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27837675		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8910368	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21966456	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29791834		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29661238		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23338277, 26058972		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30655206, 31485769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23364535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22179688		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12538661, 30655206, 30987861		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28753926		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21070749		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20388794	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39948449	Stimulate	★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	21966456		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16689996	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12538661, 18230618, 21070749, 29661238		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22276108	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Cicatricial Pemphigoid	Ocular Cicatricial Pemphigoid	CTD_human_DG	21966456		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33273889	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22355044	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31485769		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30655206	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	21966456	Inhibit	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	CTD_human_DG	21966456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	21966456	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	23364535		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23364535	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22397921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22397921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	30481825		★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	35022648	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	23155414	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23155414		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	29661238		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20951077, 31969157	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20951077		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	20947153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	21966456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	21966456		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	31000507		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22179688		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30510283, 35627105	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22870195	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26511970	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	21966456		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	30481825, 31000507		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	18632791		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40696737	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30402741	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28753926, 30402741, 31980713, 32488496	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26240828	Associate	★☆☆☆☆ Found in Text Mining only