PTGER2 (prostaglandin E receptor 2)

Gene

• Entrez ID: 5732
• Gene name: Prostaglandin E receptor 2
• Gene symbol: PTGER2
• Synonyms (NCBI Gene): COX-2, EP2
• Chromosome: 14
• Chromosome location: 14q22.1
• Summary: This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019383	hsa-miR-148b-3p	Microarray	17612493
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT1272599	hsa-miR-1276	CLIP-seq
MIRT1272600	hsa-miR-128	CLIP-seq
MIRT1272601	hsa-miR-130a	CLIP-seq
MIRT1272602	hsa-miR-130b	CLIP-seq
MIRT1272603	hsa-miR-148a	CLIP-seq
MIRT1272604	hsa-miR-148b	CLIP-seq
MIRT1272605	hsa-miR-152	CLIP-seq
MIRT1272606	hsa-miR-188-3p	CLIP-seq
MIRT1272607	hsa-miR-19a	CLIP-seq
MIRT1272608	hsa-miR-19b	CLIP-seq
MIRT1272609	hsa-miR-27a	CLIP-seq
MIRT1272610	hsa-miR-27b	CLIP-seq
MIRT1272611	hsa-miR-301a	CLIP-seq
MIRT1272612	hsa-miR-301b	CLIP-seq
MIRT1272613	hsa-miR-3666	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT1272616	hsa-miR-4295	CLIP-seq
MIRT1272617	hsa-miR-4311	CLIP-seq
MIRT1272618	hsa-miR-454	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT1272620	hsa-miR-4731-3p	CLIP-seq
MIRT1272621	hsa-miR-4801	CLIP-seq
MIRT1272622	hsa-miR-496	CLIP-seq
MIRT1272623	hsa-miR-499-3p	CLIP-seq
MIRT1272624	hsa-miR-499a-3p	CLIP-seq
MIRT1272625	hsa-miR-532-3p	CLIP-seq
MIRT1272626	hsa-miR-580	CLIP-seq
MIRT1272627	hsa-miR-583	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2080156	hsa-miR-4328	CLIP-seq
MIRT2080157	hsa-miR-4420	CLIP-seq
MIRT2080158	hsa-miR-4503	CLIP-seq
MIRT2306422	hsa-miR-2115	CLIP-seq
MIRT2306423	hsa-miR-214	CLIP-seq
MIRT2306424	hsa-miR-3619-5p	CLIP-seq
MIRT2306425	hsa-miR-3692	CLIP-seq
MIRT2306426	hsa-miR-3977	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT2306427	hsa-miR-4690-5p	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT2306428	hsa-miR-516a-3p	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2306429	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SETBP1	Repression	18419541

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	IBA
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8078484
GO:0004957	Function	Prostaglandin E receptor activity	IEA
GO:0004957	Function	Prostaglandin E receptor activity	TAS	10462542
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8078484
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10462542
GO:0006954	Process	Inflammatory response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10462542
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8078484
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0009624	Process	Response to nematode	IEA
GO:0016020	Component	Membrane	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	ISS

Other IDs

• MIM: 176804
• HGNC: 9594
• e!Ensembl: ENSG00000125384

Protein

• UniProt ID: P43116
• Protein name: Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)
• Protein function: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscl
• PDB: 7CX2, 7CX3, 7CX4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	56 → 315	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Placenta and lung.
• Sequence:

  MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
  RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
  LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
  YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
  GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
  LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

• Sequence length: 358

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Efferocytosis
Inflammatory mediator regulation of TRP channels
Renin secretion
Human cytomegalovirus infection
Pathways in cancer

Reactome:

Prostanoid ligand receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, aspirin-induced, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, NASAL POLYPS, AND ASPIRIN INTOLERANCE	—	CTD, ClinVar, Disgenet, GenCC CTD, ClinVar, Disgenet, GenCC CTD, ClinVar, Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18989535		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18666211		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	19843025		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22551900		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18825663, 28687401		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24133193	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	14558087	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15496426, 17496729, 17877755		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22432035	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Asthma, Aspirin-Induced	Asthma	CTD_human_DG	16502481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	14752026	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30374130		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	19843025		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22929011		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18319253	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34862858	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28222855	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16879213		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	16879213	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31036664		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31036664		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29569150		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20042636, 20200425		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17555711, 20200425, 24908683, 37090726	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18989535		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18989535		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	17728378		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	25595860	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20870807		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	19407222		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	19407222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	23242524, 33543288	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30989466	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29272001	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17644362		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27082296, 31250842		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33919029, 37232020	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	34831419	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	30814036		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	29982796		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	27321910	Inhibit	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24064359	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28174280, 30867357		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	16879213		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	22580611	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8910368	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28300577		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17611676, 18666211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22929011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23192657		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18666211, 22929011, 29956743, 30398879		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18319253		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20388794, 25843056, 32851536	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25595860	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	40299057	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16879213		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26051534		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31490357		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18666211, 20200425, 26965582, 29956743		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	10959556		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17533365		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22276108	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18666211		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	22929011		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	27082296		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	27321910	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19180509	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27751171	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33543288	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15347673, 22025564, 37796697	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37457723	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	36608264	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28717970		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	34886911	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	17728378		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	LHGDN	17728378		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	17728378		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23192657		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18829529		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23364535, 27012192	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25828575	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26926362	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	30485339	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24908683		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	30961940	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19542367		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31969157	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30763657, 30818067		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30510283	Associate	★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	CTD_human_DG	10359563		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26511970	Associate	★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	22123288		★☆☆☆☆ Found in Text Mining only
Ulcer of esophagus	Ulcer Of Esophagus	BEFREE	25059824		★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Ureteral neoplasms	Pubtator	34862858	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32851536	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	11344234, 31980713	Associate	★☆☆☆☆ Found in Text Mining only