Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5725
Gene name	Polypyrimidine tract binding protein 1
Gene symbol	PTBP1
Synonyms (NCBI Gene)	HNRNP-IHNRNPIHNRPIPTBPTB-1PTB-TPTB2PTB3PTB4pPTB
Chromosome	19
Chromosome location	19p13.3
Summary	This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

520

Show/Hide all (520)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001345	hsa-miR-1-3p	pSILAC	18668040
MIRT002647	hsa-miR-124-3p	Microarray	15685193
MIRT002647	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002647	hsa-miR-124-3p	Microarray	15685193
MIRT001345	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT050898	hsa-miR-17-5p	CLASH	23622248
MIRT050776	hsa-miR-17-3p	CLASH	23622248
MIRT049932	hsa-miR-30a-5p	CLASH	23622248
MIRT049413	hsa-miR-92a-3p	CLASH	23622248
MIRT046541	hsa-miR-15b-5p	CLASH	23622248
MIRT043938	hsa-miR-378a-3p	CLASH	23622248
MIRT040624	hsa-miR-92b-3p	CLASH	23622248
MIRT039680	hsa-miR-615-3p	CLASH	23622248
MIRT002647	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	23853098
MIRT002647	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	22895557
MIRT054397	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	22895557
MIRT002647	hsa-miR-124-3p	Western blotqRT-PCR	24865424
MIRT002647	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24122720
MIRT002647	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24122720
MIRT002647	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24122720
MIRT700572	hsa-miR-6854-5p	HITS-CLIP	23313552
MIRT700571	hsa-miR-6798-5p	HITS-CLIP	23313552
MIRT700570	hsa-miR-3127-3p	HITS-CLIP	23313552
MIRT700569	hsa-miR-6756-3p	HITS-CLIP	23313552
MIRT700568	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT700567	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT700566	hsa-miR-125a-5p	HITS-CLIP	23313552
MIRT700565	hsa-miR-125b-5p	HITS-CLIP	23313552
MIRT700564	hsa-miR-4319	HITS-CLIP	23313552
MIRT700563	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT700562	hsa-miR-1266-5p	HITS-CLIP	23313552
MIRT700561	hsa-miR-4518	HITS-CLIP	23313552
MIRT700560	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT700559	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT700558	hsa-miR-6087	HITS-CLIP	23313552
MIRT700557	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT700556	hsa-miR-3934-3p	HITS-CLIP	23313552
MIRT700555	hsa-miR-1273a	HITS-CLIP	23313552
MIRT700554	hsa-miR-4467	HITS-CLIP	23313552
MIRT700553	hsa-miR-670-5p	HITS-CLIP	23313552
MIRT700552	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT700551	hsa-miR-659-5p	HITS-CLIP	23313552
MIRT002647	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT002647	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT406909	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT406915	hsa-miR-3714	PAR-CLIP	20371350
MIRT566259	hsa-miR-3910	PAR-CLIP	20371350
MIRT295094	hsa-miR-4476	PAR-CLIP	20371350
MIRT295099	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT152408	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT406920	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT406921	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT406912	hsa-miR-940	PAR-CLIP	20371350
MIRT406908	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT295098	hsa-miR-6830-5p	PAR-CLIP	20371350
MIRT349266	hsa-miR-4457	PAR-CLIP	20371350
MIRT566258	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT566257	hsa-miR-1205	PAR-CLIP	20371350
MIRT566256	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT406910	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT566255	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT566254	hsa-miR-1286	PAR-CLIP	20371350
MIRT566253	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT406911	hsa-miR-657	PAR-CLIP	20371350
MIRT566252	hsa-miR-4480	PAR-CLIP	20371350
MIRT566251	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT406917	hsa-miR-4736	PAR-CLIP	20371350
MIRT566250	hsa-miR-604	PAR-CLIP	20371350
MIRT566248	hsa-miR-6762-3p	PAR-CLIP	20371350
MIRT566249	hsa-miR-4440	PAR-CLIP	20371350
MIRT566247	hsa-miR-647	PAR-CLIP	20371350
MIRT566246	hsa-miR-4477b	PAR-CLIP	20371350
MIRT406922	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT295092	hsa-miR-548n	PAR-CLIP	21572407
MIRT295097	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT295093	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT083022	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT083039	hsa-miR-548ab	PAR-CLIP	21572407
MIRT083040	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT083041	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT083042	hsa-miR-548ak	PAR-CLIP	21572407
MIRT083043	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT083046	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT083047	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT083048	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT083049	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT083050	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT083052	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT083021	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT083055	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT083023	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT083025	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT083031	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT083032	hsa-miR-548i	PAR-CLIP	21572407
MIRT083028	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT083038	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT083033	hsa-miR-548w	PAR-CLIP	21572407
MIRT083036	hsa-miR-548y	PAR-CLIP	21572407
MIRT083020	hsa-miR-559	PAR-CLIP	21572407
MIRT295104	hsa-miR-624-3p	PAR-CLIP	21572407
MIRT295105	hsa-miR-802	PAR-CLIP	21572407
MIRT295108	hsa-miR-3163	PAR-CLIP	21572407
MIRT295098	hsa-miR-6830-5p	PAR-CLIP	21572407
MIRT295101	hsa-miR-194-5p	PAR-CLIP	21572407
MIRT083018	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT083018	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT001345	hsa-miR-1-3p	Luciferase reporter assayqRT-PCRWestern blot	26980745
MIRT001345	hsa-miR-1-3p	Luciferase reporter assayqRT-PCRWestern blot	26980745
MIRT002647	hsa-miR-124-3p	PAR-CLIP	26701625
MIRT406908	hsa-miR-329-5p	PAR-CLIP	26701625
MIRT406915	hsa-miR-3714	PAR-CLIP	26701625
MIRT566259	hsa-miR-3910	PAR-CLIP	26701625
MIRT349266	hsa-miR-4457	PAR-CLIP	26701625
MIRT566246	hsa-miR-4477b	PAR-CLIP	26701625
MIRT566252	hsa-miR-4480	PAR-CLIP	26701625
MIRT406917	hsa-miR-4736	PAR-CLIP	26701625
MIRT566256	hsa-miR-4786-3p	PAR-CLIP	26701625
MIRT406909	hsa-miR-506-3p	PAR-CLIP	26701625
MIRT152408	hsa-miR-5582-5p	PAR-CLIP	26701625
MIRT406910	hsa-miR-605-3p	PAR-CLIP	26701625
MIRT406911	hsa-miR-657	PAR-CLIP	26701625
MIRT566251	hsa-miR-671-5p	PAR-CLIP	26701625
MIRT406920	hsa-miR-6808-5p	PAR-CLIP	26701625
MIRT295098	hsa-miR-6830-5p	PAR-CLIP	26701625
MIRT406921	hsa-miR-6893-5p	PAR-CLIP	26701625
MIRT406922	hsa-miR-7856-5p	PAR-CLIP	26701625
MIRT406912	hsa-miR-940	PAR-CLIP	26701625
MIRT732526	hsa-miR-133a-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCR	33654410
MIRT733111	hsa-miR-644a	ImmunofluorescenceIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33520363
MIRT737171	hsa-miR-501-5p	RNA-seqqRT-PCR	34148372
MIRT700572	hsa-miR-6854-5p	HITS-CLIP	23313552
MIRT700571	hsa-miR-6798-5p	HITS-CLIP	23313552
MIRT700570	hsa-miR-3127-3p	HITS-CLIP	23313552
MIRT700569	hsa-miR-6756-3p	HITS-CLIP	23313552
MIRT700568	hsa-miR-7108-3p	HITS-CLIP	23313552
MIRT700567	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT700566	hsa-miR-125a-5p	HITS-CLIP	23313552
MIRT700565	hsa-miR-125b-5p	HITS-CLIP	23313552
MIRT700564	hsa-miR-4319	HITS-CLIP	23313552
MIRT700563	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT700562	hsa-miR-1266-5p	HITS-CLIP	23313552
MIRT700561	hsa-miR-4518	HITS-CLIP	23313552
MIRT700560	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT700559	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT700558	hsa-miR-6087	HITS-CLIP	23313552
MIRT700557	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT700556	hsa-miR-3934-3p	HITS-CLIP	23313552
MIRT700555	hsa-miR-1273a	HITS-CLIP	23313552
MIRT700554	hsa-miR-4467	HITS-CLIP	23313552
MIRT700553	hsa-miR-670-5p	HITS-CLIP	23313552
MIRT700552	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT700551	hsa-miR-659-5p	HITS-CLIP	23313552
MIRT002647	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT002647	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT406909	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT406915	hsa-miR-3714	PAR-CLIP	20371350
MIRT566259	hsa-miR-3910	PAR-CLIP	20371350
MIRT295094	hsa-miR-4476	PAR-CLIP	20371350
MIRT295099	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT152408	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT406920	hsa-miR-6808-5p	PAR-CLIP	20371350
MIRT406921	hsa-miR-6893-5p	PAR-CLIP	20371350
MIRT406912	hsa-miR-940	PAR-CLIP	20371350
MIRT406908	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT295098	hsa-miR-6830-5p	PAR-CLIP	20371350
MIRT349266	hsa-miR-4457	PAR-CLIP	20371350
MIRT566258	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT566257	hsa-miR-1205	PAR-CLIP	20371350
MIRT566256	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT406910	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT566255	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT566254	hsa-miR-1286	PAR-CLIP	20371350
MIRT566253	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT406911	hsa-miR-657	PAR-CLIP	20371350
MIRT566252	hsa-miR-4480	PAR-CLIP	20371350
MIRT566251	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT406917	hsa-miR-4736	PAR-CLIP	20371350
MIRT566250	hsa-miR-604	PAR-CLIP	20371350
MIRT566248	hsa-miR-6762-3p	PAR-CLIP	20371350
MIRT566249	hsa-miR-4440	PAR-CLIP	20371350
MIRT566247	hsa-miR-647	PAR-CLIP	20371350
MIRT566246	hsa-miR-4477b	PAR-CLIP	20371350
MIRT406922	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT295092	hsa-miR-548n	PAR-CLIP	21572407
MIRT295097	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT295093	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT083022	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT083039	hsa-miR-548ab	PAR-CLIP	21572407
MIRT083040	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT083041	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT083042	hsa-miR-548ak	PAR-CLIP	21572407
MIRT083043	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT083046	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT083047	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT083048	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT083049	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT083050	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT083052	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT083021	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT083055	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT083023	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT083025	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT083031	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT083032	hsa-miR-548i	PAR-CLIP	21572407
MIRT083028	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT083038	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT083033	hsa-miR-548w	PAR-CLIP	21572407
MIRT083036	hsa-miR-548y	PAR-CLIP	21572407
MIRT083020	hsa-miR-559	PAR-CLIP	21572407
MIRT295104	hsa-miR-624-3p	PAR-CLIP	21572407
MIRT295105	hsa-miR-802	PAR-CLIP	21572407
MIRT295108	hsa-miR-3163	PAR-CLIP	21572407
MIRT295098	hsa-miR-6830-5p	PAR-CLIP	21572407
MIRT295101	hsa-miR-194-5p	PAR-CLIP	21572407
MIRT755324	hsa-mir-506-3p	Luciferase reporter assayWestern blotting	37169555
MIRT1271674	hsa-miR-1197	CLIP-seq
MIRT1271675	hsa-miR-147	CLIP-seq
MIRT1271676	hsa-miR-2355-5p	CLIP-seq
MIRT1271677	hsa-miR-2964a-3p	CLIP-seq
MIRT1271678	hsa-miR-302f	CLIP-seq
MIRT1271679	hsa-miR-3189-3p	CLIP-seq
MIRT1271680	hsa-miR-3650	CLIP-seq
MIRT1271681	hsa-miR-3911	CLIP-seq
MIRT1271682	hsa-miR-4436a	CLIP-seq
MIRT1271683	hsa-miR-4455	CLIP-seq
MIRT1271684	hsa-miR-4474-3p	CLIP-seq
MIRT1271685	hsa-miR-4766-3p	CLIP-seq
MIRT1271686	hsa-miR-548p	CLIP-seq
MIRT1271687	hsa-miR-599	CLIP-seq
MIRT1271688	hsa-miR-609	CLIP-seq
MIRT1271689	hsa-miR-644	CLIP-seq
MIRT1271690	hsa-miR-124	CLIP-seq
MIRT1271691	hsa-miR-125a-3p	CLIP-seq
MIRT1271692	hsa-miR-3665	CLIP-seq
MIRT1271693	hsa-miR-4418	CLIP-seq
MIRT1271694	hsa-miR-4493	CLIP-seq
MIRT1271695	hsa-miR-506	CLIP-seq
MIRT1271696	hsa-miR-509-3-5p	CLIP-seq
MIRT1271697	hsa-miR-509-5p	CLIP-seq
MIRT1271698	hsa-miR-645	CLIP-seq
MIRT1271699	hsa-miR-1	CLIP-seq
MIRT1271700	hsa-miR-106a	CLIP-seq
MIRT1271701	hsa-miR-106b	CLIP-seq
MIRT1271702	hsa-miR-1207-3p	CLIP-seq
MIRT1271690	hsa-miR-124	CLIP-seq
MIRT1271703	hsa-miR-1252	CLIP-seq
MIRT1271704	hsa-miR-1254	CLIP-seq
MIRT1271705	hsa-miR-1291	CLIP-seq
MIRT1271706	hsa-miR-1299	CLIP-seq
MIRT1271707	hsa-miR-133a	CLIP-seq
MIRT1271708	hsa-miR-137	CLIP-seq
MIRT1271709	hsa-miR-153	CLIP-seq
MIRT1271710	hsa-miR-17	CLIP-seq
MIRT1271711	hsa-miR-1827	CLIP-seq
MIRT1271712	hsa-miR-1908	CLIP-seq
MIRT1271713	hsa-miR-191	CLIP-seq
MIRT1271714	hsa-miR-193b	CLIP-seq
MIRT1271715	hsa-miR-194	CLIP-seq
MIRT1271716	hsa-miR-200b	CLIP-seq
MIRT1271717	hsa-miR-200c	CLIP-seq
MIRT1271718	hsa-miR-206	CLIP-seq
MIRT1271719	hsa-miR-20a	CLIP-seq
MIRT1271720	hsa-miR-20b	CLIP-seq
MIRT1271721	hsa-miR-210	CLIP-seq
MIRT1271722	hsa-miR-2117	CLIP-seq
MIRT1271723	hsa-miR-2276	CLIP-seq
MIRT1271724	hsa-miR-298	CLIP-seq
MIRT1271725	hsa-miR-300	CLIP-seq
MIRT1271726	hsa-miR-3116	CLIP-seq
MIRT1271727	hsa-miR-3119	CLIP-seq
MIRT1271728	hsa-miR-3135b	CLIP-seq
MIRT1271729	hsa-miR-3154	CLIP-seq
MIRT1271730	hsa-miR-3164	CLIP-seq
MIRT1271731	hsa-miR-3179	CLIP-seq
MIRT1271732	hsa-miR-3180	CLIP-seq
MIRT1271733	hsa-miR-3180-3p	CLIP-seq
MIRT1271734	hsa-miR-3196	CLIP-seq
MIRT1271735	hsa-miR-326	CLIP-seq
MIRT1271736	hsa-miR-330-5p	CLIP-seq
MIRT1271737	hsa-miR-331-3p	CLIP-seq
MIRT1271738	hsa-miR-338-3p	CLIP-seq
MIRT1271739	hsa-miR-342-3p	CLIP-seq
MIRT1271740	hsa-miR-3609	CLIP-seq
MIRT1271741	hsa-miR-3610	CLIP-seq
MIRT1271742	hsa-miR-3622a-5p	CLIP-seq
MIRT1271743	hsa-miR-3646	CLIP-seq
MIRT1271744	hsa-miR-369-3p	CLIP-seq
MIRT1271745	hsa-miR-374a	CLIP-seq
MIRT1271746	hsa-miR-374b	CLIP-seq
MIRT1271747	hsa-miR-374c	CLIP-seq
MIRT1271748	hsa-miR-381	CLIP-seq
MIRT1271749	hsa-miR-3973	CLIP-seq
MIRT1271750	hsa-miR-410	CLIP-seq
MIRT1271751	hsa-miR-4257	CLIP-seq
MIRT1271752	hsa-miR-4267	CLIP-seq
MIRT1271753	hsa-miR-4282	CLIP-seq
MIRT1271754	hsa-miR-429	CLIP-seq
MIRT1271755	hsa-miR-4292	CLIP-seq
MIRT1271756	hsa-miR-4423-3p	CLIP-seq
MIRT1271684	hsa-miR-4474-3p	CLIP-seq
MIRT1271757	hsa-miR-448	CLIP-seq
MIRT1271758	hsa-miR-4488	CLIP-seq
MIRT1271759	hsa-miR-450b-5p	CLIP-seq
MIRT1271760	hsa-miR-4632	CLIP-seq
MIRT1271761	hsa-miR-4670-3p	CLIP-seq
MIRT1271762	hsa-miR-4697-5p	CLIP-seq
MIRT1271763	hsa-miR-4706	CLIP-seq
MIRT1271764	hsa-miR-4711-5p	CLIP-seq
MIRT1271765	hsa-miR-4742-5p	CLIP-seq
MIRT1271766	hsa-miR-4749-3p	CLIP-seq
MIRT1271767	hsa-miR-4749-5p	CLIP-seq
MIRT1271768	hsa-miR-4756-3p	CLIP-seq
MIRT1271769	hsa-miR-4760-5p	CLIP-seq
MIRT1271770	hsa-miR-4768-5p	CLIP-seq
MIRT1271771	hsa-miR-4772-3p	CLIP-seq
MIRT1271772	hsa-miR-4781-5p	CLIP-seq
MIRT1271773	hsa-miR-4796-3p	CLIP-seq
MIRT1271774	hsa-miR-4797-5p	CLIP-seq
MIRT1271775	hsa-miR-486-3p	CLIP-seq
MIRT1271776	hsa-miR-503	CLIP-seq
MIRT1271695	hsa-miR-506	CLIP-seq
MIRT1271777	hsa-miR-507	CLIP-seq
MIRT1271778	hsa-miR-513b	CLIP-seq
MIRT1271779	hsa-miR-518a-5p	CLIP-seq
MIRT1271780	hsa-miR-519d	CLIP-seq
MIRT1271781	hsa-miR-527	CLIP-seq
MIRT1271782	hsa-miR-548a-3p	CLIP-seq
MIRT1271783	hsa-miR-548ac	CLIP-seq
MIRT1271784	hsa-miR-548ag	CLIP-seq
MIRT1271785	hsa-miR-548ah	CLIP-seq
MIRT1271786	hsa-miR-548ai	CLIP-seq
MIRT1271787	hsa-miR-548d-3p	CLIP-seq
MIRT1271788	hsa-miR-548e	CLIP-seq
MIRT1271789	hsa-miR-548f	CLIP-seq
MIRT1271790	hsa-miR-548h	CLIP-seq
MIRT1271791	hsa-miR-548j	CLIP-seq
MIRT1271792	hsa-miR-548l	CLIP-seq
MIRT1271793	hsa-miR-548t	CLIP-seq
MIRT1271794	hsa-miR-548z	CLIP-seq
MIRT1271795	hsa-miR-553	CLIP-seq
MIRT1271796	hsa-miR-555	CLIP-seq
MIRT1271797	hsa-miR-557	CLIP-seq
MIRT1271798	hsa-miR-613	CLIP-seq
MIRT1271799	hsa-miR-615-5p	CLIP-seq
MIRT1271800	hsa-miR-624	CLIP-seq
MIRT1271801	hsa-miR-637	CLIP-seq
MIRT1271802	hsa-miR-655	CLIP-seq
MIRT1271803	hsa-miR-661	CLIP-seq
MIRT1271804	hsa-miR-663	CLIP-seq
MIRT1271805	hsa-miR-875-3p	CLIP-seq
MIRT1271806	hsa-miR-891b	CLIP-seq
MIRT1271807	hsa-miR-93	CLIP-seq
MIRT1271808	hsa-miR-939	CLIP-seq
MIRT1271699	hsa-miR-1	CLIP-seq
MIRT1271702	hsa-miR-1207-3p	CLIP-seq
MIRT1271690	hsa-miR-124	CLIP-seq
MIRT2079865	hsa-miR-125b	CLIP-seq
MIRT2079866	hsa-miR-1266	CLIP-seq
MIRT1271706	hsa-miR-1299	CLIP-seq
MIRT1271707	hsa-miR-133a	CLIP-seq
MIRT1271713	hsa-miR-191	CLIP-seq
MIRT2079867	hsa-miR-1914	CLIP-seq
MIRT1271716	hsa-miR-200b	CLIP-seq
MIRT1271717	hsa-miR-200c	CLIP-seq
MIRT1271718	hsa-miR-206	CLIP-seq
MIRT1271721	hsa-miR-210	CLIP-seq
MIRT1271722	hsa-miR-2117	CLIP-seq
MIRT1271723	hsa-miR-2276	CLIP-seq
MIRT1271735	hsa-miR-326	CLIP-seq
MIRT1271736	hsa-miR-330-5p	CLIP-seq
MIRT2079868	hsa-miR-339-5p	CLIP-seq
MIRT1271741	hsa-miR-3610	CLIP-seq
MIRT2079869	hsa-miR-3672	CLIP-seq
MIRT1271744	hsa-miR-369-3p	CLIP-seq
MIRT1271745	hsa-miR-374a	CLIP-seq
MIRT1271746	hsa-miR-374b	CLIP-seq
MIRT1271747	hsa-miR-374c	CLIP-seq
MIRT1271749	hsa-miR-3973	CLIP-seq
MIRT2079870	hsa-miR-3974	CLIP-seq
MIRT1271750	hsa-miR-410	CLIP-seq
MIRT1271753	hsa-miR-4282	CLIP-seq
MIRT2079871	hsa-miR-4283	CLIP-seq
MIRT1271754	hsa-miR-429	CLIP-seq
MIRT2079872	hsa-miR-4486	CLIP-seq
MIRT2079873	hsa-miR-4508	CLIP-seq
MIRT2079874	hsa-miR-4639-5p	CLIP-seq
MIRT2079875	hsa-miR-4655-5p	CLIP-seq
MIRT2079876	hsa-miR-4662a-3p	CLIP-seq
MIRT1271768	hsa-miR-4756-3p	CLIP-seq
MIRT1271770	hsa-miR-4768-5p	CLIP-seq
MIRT1271771	hsa-miR-4772-3p	CLIP-seq
MIRT1271774	hsa-miR-4797-5p	CLIP-seq
MIRT1271695	hsa-miR-506	CLIP-seq
MIRT1271778	hsa-miR-513b	CLIP-seq
MIRT1271779	hsa-miR-518a-5p	CLIP-seq
MIRT1271781	hsa-miR-527	CLIP-seq
MIRT1271792	hsa-miR-548l	CLIP-seq
MIRT1271796	hsa-miR-555	CLIP-seq
MIRT2079877	hsa-miR-592	CLIP-seq
MIRT2079878	hsa-miR-597	CLIP-seq
MIRT1271687	hsa-miR-599	CLIP-seq
MIRT1271798	hsa-miR-613	CLIP-seq
MIRT1271802	hsa-miR-655	CLIP-seq
MIRT2079879	hsa-miR-670	CLIP-seq
MIRT1271805	hsa-miR-875-3p	CLIP-seq
MIRT1271806	hsa-miR-891b	CLIP-seq
MIRT2079880	hsa-miR-9	CLIP-seq
MIRT1271699	hsa-miR-1	CLIP-seq
MIRT1271702	hsa-miR-1207-3p	CLIP-seq
MIRT2306180	hsa-miR-1224-3p	CLIP-seq
MIRT2306181	hsa-miR-1225-3p	CLIP-seq
MIRT1271690	hsa-miR-124	CLIP-seq
MIRT1271704	hsa-miR-1254	CLIP-seq
MIRT1271691	hsa-miR-125a-3p	CLIP-seq
MIRT1271705	hsa-miR-1291	CLIP-seq
MIRT1271706	hsa-miR-1299	CLIP-seq
MIRT2306182	hsa-miR-1321	CLIP-seq
MIRT1271707	hsa-miR-133a	CLIP-seq
MIRT1271708	hsa-miR-137	CLIP-seq
MIRT1271711	hsa-miR-1827	CLIP-seq
MIRT1271712	hsa-miR-1908	CLIP-seq
MIRT1271713	hsa-miR-191	CLIP-seq
MIRT1271714	hsa-miR-193b	CLIP-seq
MIRT1271716	hsa-miR-200b	CLIP-seq
MIRT1271717	hsa-miR-200c	CLIP-seq
MIRT1271718	hsa-miR-206	CLIP-seq
MIRT1271721	hsa-miR-210	CLIP-seq
MIRT1271723	hsa-miR-2276	CLIP-seq
MIRT1271724	hsa-miR-298	CLIP-seq
MIRT1271725	hsa-miR-300	CLIP-seq
MIRT1271726	hsa-miR-3116	CLIP-seq
MIRT1271728	hsa-miR-3135b	CLIP-seq
MIRT1271729	hsa-miR-3154	CLIP-seq
MIRT1271730	hsa-miR-3164	CLIP-seq
MIRT1271731	hsa-miR-3179	CLIP-seq
MIRT1271732	hsa-miR-3180	CLIP-seq
MIRT1271733	hsa-miR-3180-3p	CLIP-seq
MIRT1271734	hsa-miR-3196	CLIP-seq
MIRT1271735	hsa-miR-326	CLIP-seq
MIRT1271736	hsa-miR-330-5p	CLIP-seq
MIRT1271737	hsa-miR-331-3p	CLIP-seq
MIRT2306183	hsa-miR-335	CLIP-seq
MIRT1271738	hsa-miR-338-3p	CLIP-seq
MIRT1271742	hsa-miR-3622a-5p	CLIP-seq
MIRT2306184	hsa-miR-3622b-5p	CLIP-seq
MIRT1271692	hsa-miR-3665	CLIP-seq
MIRT1271744	hsa-miR-369-3p	CLIP-seq
MIRT2306185	hsa-miR-371-5p	CLIP-seq
MIRT2306186	hsa-miR-371b-5p	CLIP-seq
MIRT1271745	hsa-miR-374a	CLIP-seq
MIRT1271746	hsa-miR-374b	CLIP-seq
MIRT1271747	hsa-miR-374c	CLIP-seq
MIRT1271748	hsa-miR-381	CLIP-seq
MIRT2306187	hsa-miR-3943	CLIP-seq
MIRT1271749	hsa-miR-3973	CLIP-seq
MIRT1271750	hsa-miR-410	CLIP-seq
MIRT1271751	hsa-miR-4257	CLIP-seq
MIRT1271752	hsa-miR-4267	CLIP-seq
MIRT1271754	hsa-miR-429	CLIP-seq
MIRT1271755	hsa-miR-4292	CLIP-seq
MIRT2306188	hsa-miR-4293	CLIP-seq
MIRT2306189	hsa-miR-4305	CLIP-seq
MIRT1271693	hsa-miR-4418	CLIP-seq
MIRT1271756	hsa-miR-4423-3p	CLIP-seq
MIRT1271684	hsa-miR-4474-3p	CLIP-seq
MIRT1271758	hsa-miR-4488	CLIP-seq
MIRT1271694	hsa-miR-4493	CLIP-seq
MIRT2079873	hsa-miR-4508	CLIP-seq
MIRT1271762	hsa-miR-4697-5p	CLIP-seq
MIRT2306190	hsa-miR-4700-3p	CLIP-seq
MIRT2306191	hsa-miR-4704-3p	CLIP-seq
MIRT1271763	hsa-miR-4706	CLIP-seq
MIRT1271764	hsa-miR-4711-5p	CLIP-seq
MIRT2306192	hsa-miR-4739	CLIP-seq
MIRT1271765	hsa-miR-4742-5p	CLIP-seq
MIRT2306193	hsa-miR-4747-5p	CLIP-seq
MIRT1271767	hsa-miR-4749-5p	CLIP-seq
MIRT1271768	hsa-miR-4756-3p	CLIP-seq
MIRT2306194	hsa-miR-4756-5p	CLIP-seq
MIRT2306195	hsa-miR-4758-3p	CLIP-seq
MIRT1271769	hsa-miR-4760-5p	CLIP-seq
MIRT1271771	hsa-miR-4772-3p	CLIP-seq
MIRT1271772	hsa-miR-4781-5p	CLIP-seq
MIRT1271774	hsa-miR-4797-5p	CLIP-seq
MIRT1271775	hsa-miR-486-3p	CLIP-seq
MIRT1271776	hsa-miR-503	CLIP-seq
MIRT1271695	hsa-miR-506	CLIP-seq
MIRT1271696	hsa-miR-509-3-5p	CLIP-seq
MIRT1271697	hsa-miR-509-5p	CLIP-seq
MIRT2306196	hsa-miR-513c	CLIP-seq
MIRT2306197	hsa-miR-514b-5p	CLIP-seq
MIRT1271779	hsa-miR-518a-5p	CLIP-seq
MIRT1271781	hsa-miR-527	CLIP-seq
MIRT1271784	hsa-miR-548ag	CLIP-seq
MIRT1271786	hsa-miR-548ai	CLIP-seq
MIRT1271792	hsa-miR-548l	CLIP-seq
MIRT1271795	hsa-miR-553	CLIP-seq
MIRT1271798	hsa-miR-613	CLIP-seq
MIRT1271799	hsa-miR-615-5p	CLIP-seq
MIRT1271800	hsa-miR-624	CLIP-seq
MIRT1271801	hsa-miR-637	CLIP-seq
MIRT1271698	hsa-miR-645	CLIP-seq
MIRT1271802	hsa-miR-655	CLIP-seq
MIRT1271803	hsa-miR-661	CLIP-seq
MIRT1271804	hsa-miR-663	CLIP-seq
MIRT2306198	hsa-miR-765	CLIP-seq
MIRT1271805	hsa-miR-875-3p	CLIP-seq
MIRT1271806	hsa-miR-891b	CLIP-seq
MIRT1271808	hsa-miR-939	CLIP-seq
MIRT1271706	hsa-miR-1299	CLIP-seq
MIRT2603469	hsa-miR-134	CLIP-seq
MIRT2603470	hsa-miR-3118	CLIP-seq
MIRT1271730	hsa-miR-3164	CLIP-seq
MIRT1271735	hsa-miR-326	CLIP-seq
MIRT1271736	hsa-miR-330-5p	CLIP-seq
MIRT2603471	hsa-miR-4261	CLIP-seq
MIRT2079872	hsa-miR-4486	CLIP-seq
MIRT2603472	hsa-miR-4722-3p	CLIP-seq
MIRT2603473	hsa-miR-4738-3p	CLIP-seq
MIRT1271805	hsa-miR-875-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYC	Activation	20010808

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	16260624, 21518792
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	1906036
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	10653975, 11514619, 16189514, 16373488, 16713569, 21911577, 22365833, 25416956, 26871637, 29924966, 31324722, 31515488, 32814053, 36012204, 39009827
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS	1641332
GO:0005730	Component	Nucleolus	TAS	1641332
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	1906036
GO:0008187	Function	Poly-pyrimidine tract binding	TAS	1906036
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	TAS	1906036
GO:0010467	Process	Gene expression	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022008	Process	Neurogenesis	IEA
GO:0033119	Process	Negative regulation of RNA splicing	IDA	18335065
GO:0033119	Process	Negative regulation of RNA splicing	IEA
GO:0036002	Function	Pre-mRNA binding	IDA	16260624
GO:0043484	Process	Regulation of RNA splicing	IBA
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IDA	15009664
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IEA
GO:0051148	Process	Negative regulation of muscle cell differentiation	IDA	21518792
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IMP	23853098
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	17947529
GO:0075522	Process	IRES-dependent viral translational initiation	IMP	21518806
GO:1903312	Process	Negative regulation of mRNA metabolic process	IEA

MIM	HGNC	e!Ensembl
600693	9583	ENSG00000011304

P26599

Protein name

Polypyrimidine tract-binding protein 1 (PTB) (57 kDa RNA-binding protein PPTB-1) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I)

Protein function

Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bo

PDB

1QM9 , 1SJQ , 1SJR , 2AD9 , 2ADB , 2ADC , 2EVZ , 2N3O , 3ZZY , 3ZZZ , 8BGF , 8BWF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13893	RRM_5	40 → 152		Domain
PF00076	RRM_1	186 → 252	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF13893	RRM_5	309 → 433		Domain
PF00076	RRM_1	456 → 521	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS
VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGV
YGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGV
VKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Sequence length

531

Interactions

View interactions

	Reactome
			FGFR2 alternative splicing mRNA Splicing - Major Pathway Processing of Capped Intron-Containing Pre-mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
PTBP1-related neurodevelopmental disorder with skeletal dysplasia	Pathogenic	rs2145008460, rs1599210325	RCV006252383 RCV006252382	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (162)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31387917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26980745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36595978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21846794, 31208978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19781077, 19833869, 20133711, 22055719, 22957047, 23042786, 24262168, 24840975, 24899262, 24920338, 25239623, 25429138, 26330466, 26895297, 28549443 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32217641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	19781077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	23046583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26234680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30340104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37717070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	14769134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30340104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12509450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28106737, 28380435, 30012566, 30742945, 31304601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	33141183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28024117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19728080, 23695548, 24840202, 29856478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22911749, 25913416, 29453318, 38176460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21960125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17310993, 21976412, 26860615, 29453318, 30696738, 31729427, 35651729, 36595978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	14562043		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36529521, 38230456, 40264052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36595978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28106737, 28380435, 30012566, 30742945, 31304601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12644826, 15205328, 24722255, 28038443, 30568224, 31075540, 31819557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17310993, 20856201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26234680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36970727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15269137, 20727170, 26717985, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36635270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	27770549, 30778047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26566043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	21099291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28296893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19686745, 25818238, 30219676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25904505, 28296893, 28404950, 31064870, 31316988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26860615, 30219676, 34158864, 36727289, 38273088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26980745, 27836735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20219773, 28337374, 29512730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	24103357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	32217641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30594394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21099291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25927630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30594394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25927630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36792603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25528059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	26234680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28724967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20727170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	24840975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29140550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	12594214, 21900387, 24462888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19781077, 23042786, 26614389, 28663553, 31551693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	18223198, 19833869, 20133711, 22957047, 24840975, 26895297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21976412, 24865424, 26100017, 29592812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21976412, 24865424, 29415469, 29592812, 33141183, 35871232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21976412, 26100017, 29592812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	14769134, 16729017, 19506066, 21655185, 24286314, 26047657, 31253583, 31862871, 35299889, 36171198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19506066, 21655185, 26933087, 28282372, 28790173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	30665514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29518215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30468920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29453318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	37061531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27378699		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYPERCHOLESTEROLEMIA, AUTOSOMAL RECESSIVE	Hypercholesterolemia	BEFREE	15599766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30353369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28971999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29664037, 30476084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26566043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31400113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28414323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30799057, 31387917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12054577, 26346275, 31301177, 31762817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12054577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15159028, 31729427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30568224, 31729427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30742945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19728080, 23695548, 24840202, 29453318, 29856478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22646166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 15184870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12644826, 15205328, 24722255, 28038443, 30568224, 31075540, 31819557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15269137, 26717985, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29286182, 31355266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24823909, 29658587, 30078000, 30746571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28106737, 28380435, 30012566, 30742945, 31304601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14562043, 17927519, 18481990, 20157568, 20305372, 21565971, 23807417, 24516048, 24722255, 25362645, 26046131, 26149387, 27615744, 27940961, 28337374 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	12644826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19686745, 25818238, 30219676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31010427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29453318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	14769134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17409413, 18454174, 20439467, 30936459		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	25169209	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36595978	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28493484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	39206910	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20190818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32655719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32217641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	26362252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	19147685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31627147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	22125086		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY WITH EXERCISE INTOLERANCE, SWEDISH TYPE	Myopathy	BEFREE	30209894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	9371827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14562043, 20186023, 21976412, 23618401, 24532040, 25818238, 26056275, 26189797, 26336992, 26438629, 26602816, 26933087, 27771769, 28337374, 28731284 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12185581, 26683771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26683771, 9094658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	24103357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32217641, 33254518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19781077, 20133711, 23721326, 24842888, 28912172, 30357366, 30692134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30014466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30664220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21862584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	20133602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33621196	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	15269137, 26717985, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17310993, 20856201, 22972848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29286182, 31355266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31355266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15827745, 25646437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25646437, 26566043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	33254518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	24262168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	26614389, 28663553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27075719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14654946, 24823909, 29658587, 30078000, 30746571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33893085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28971999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20219773, 29512730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	21960125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28981396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	8843857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35651729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	8843857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27836735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22016766, 27941877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24085785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20816961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29140550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24796666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27696637, 36635500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	8843857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	31253634, 31754036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28380435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37042849, 39206910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26293469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PTBP1 (polypyrimidine tract binding protein 1)