Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5723
Gene name	Phosphoserine phosphatase
Gene symbol	PSPH
Synonyms (NCBI Gene)	PSPPSPHD
Chromosome	7
Chromosome location	7p11.2
Summary	The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs73343752	A>G	Likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, non coding transcript variant, coding sequence variant
rs104894035	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs104894036	A>G	Pathogenic	Non coding transcript variant, intron variant, coding sequence variant, missense variant
rs786204793	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

389

Show/Hide all (389)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023338	hsa-miR-122-5p	Proteomics	21750653
MIRT032012	hsa-miR-16-5p	Proteomics	18668040
MIRT038375	hsa-miR-296-3p	CLASH	23622248
MIRT654660	hsa-miR-3163	HITS-CLIP	23824327
MIRT654659	hsa-miR-4729	HITS-CLIP	23824327
MIRT654658	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT654657	hsa-miR-496	HITS-CLIP	23824327
MIRT654656	hsa-miR-340-5p	HITS-CLIP	23824327
MIRT654655	hsa-miR-5696	HITS-CLIP	23824327
MIRT654654	hsa-miR-4444	HITS-CLIP	23824327
MIRT654660	hsa-miR-3163	HITS-CLIP	23824327
MIRT654659	hsa-miR-4729	HITS-CLIP	23824327
MIRT654658	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT654657	hsa-miR-496	HITS-CLIP	23824327
MIRT654656	hsa-miR-340-5p	HITS-CLIP	23824327
MIRT654655	hsa-miR-5696	HITS-CLIP	23824327
MIRT654654	hsa-miR-4444	HITS-CLIP	23824327
MIRT1271103	hsa-miR-1243	CLIP-seq
MIRT1271104	hsa-miR-139-5p	CLIP-seq
MIRT1271105	hsa-miR-144	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271107	hsa-miR-1908	CLIP-seq
MIRT1271108	hsa-miR-200b	CLIP-seq
MIRT1271109	hsa-miR-200c	CLIP-seq
MIRT1271110	hsa-miR-2114	CLIP-seq
MIRT1271111	hsa-miR-297	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT1271113	hsa-miR-3136-3p	CLIP-seq
MIRT1271114	hsa-miR-3149	CLIP-seq
MIRT1271115	hsa-miR-3178	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT1271118	hsa-miR-3654	CLIP-seq
MIRT1271119	hsa-miR-3656	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1271122	hsa-miR-369-3p	CLIP-seq
MIRT1271123	hsa-miR-374a	CLIP-seq
MIRT1271124	hsa-miR-374b	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271128	hsa-miR-3974	CLIP-seq
MIRT1271129	hsa-miR-4252	CLIP-seq
MIRT1271130	hsa-miR-429	CLIP-seq
MIRT1271131	hsa-miR-4327	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT1271133	hsa-miR-4422	CLIP-seq
MIRT1271134	hsa-miR-4433	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271136	hsa-miR-4459	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT1271138	hsa-miR-4486	CLIP-seq
MIRT1271139	hsa-miR-4537	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271141	hsa-miR-4683	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT1271145	hsa-miR-4793-3p	CLIP-seq
MIRT1271146	hsa-miR-4793-5p	CLIP-seq
MIRT1271147	hsa-miR-4794	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271150	hsa-miR-508-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT1271152	hsa-miR-550a	CLIP-seq
MIRT1271153	hsa-miR-582-5p	CLIP-seq
MIRT1271154	hsa-miR-624	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT1271156	hsa-miR-663	CLIP-seq
MIRT1271157	hsa-miR-663b	CLIP-seq
MIRT1271158	hsa-miR-766	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT1552664	hsa-miR-382	CLIP-seq
MIRT2079737	hsa-miR-1197	CLIP-seq
MIRT2079738	hsa-miR-1251	CLIP-seq
MIRT2079739	hsa-miR-1285	CLIP-seq
MIRT2079740	hsa-miR-1323	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271107	hsa-miR-1908	CLIP-seq
MIRT1271110	hsa-miR-2114	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT2079741	hsa-miR-3187-5p	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT1271119	hsa-miR-3656	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1552664	hsa-miR-382	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT2079742	hsa-miR-3942-3p	CLIP-seq
MIRT1271128	hsa-miR-3974	CLIP-seq
MIRT1271129	hsa-miR-4252	CLIP-seq
MIRT1271131	hsa-miR-4327	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT1271134	hsa-miR-4433	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271136	hsa-miR-4459	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT2079743	hsa-miR-451b	CLIP-seq
MIRT1271139	hsa-miR-4537	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271141	hsa-miR-4683	CLIP-seq
MIRT2079744	hsa-miR-4719	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT2079745	hsa-miR-4778-5p	CLIP-seq
MIRT1271145	hsa-miR-4793-3p	CLIP-seq
MIRT1271146	hsa-miR-4793-5p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271150	hsa-miR-508-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT2079746	hsa-miR-548o	CLIP-seq
MIRT1271152	hsa-miR-550a	CLIP-seq
MIRT2079747	hsa-miR-612	CLIP-seq
MIRT1271154	hsa-miR-624	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT2079748	hsa-miR-661	CLIP-seq
MIRT1271156	hsa-miR-663	CLIP-seq
MIRT1271158	hsa-miR-766	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT2306051	hsa-miR-1183	CLIP-seq
MIRT2079737	hsa-miR-1197	CLIP-seq
MIRT1271103	hsa-miR-1243	CLIP-seq
MIRT2079739	hsa-miR-1285	CLIP-seq
MIRT1271104	hsa-miR-139-5p	CLIP-seq
MIRT1271105	hsa-miR-144	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271108	hsa-miR-200b	CLIP-seq
MIRT1271109	hsa-miR-200c	CLIP-seq
MIRT2306052	hsa-miR-2054	CLIP-seq
MIRT1271111	hsa-miR-297	CLIP-seq
MIRT2306053	hsa-miR-3120-5p	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT1271114	hsa-miR-3149	CLIP-seq
MIRT2306054	hsa-miR-3159	CLIP-seq
MIRT2079741	hsa-miR-3187-5p	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT2306055	hsa-miR-3613-3p	CLIP-seq
MIRT1271118	hsa-miR-3654	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1271122	hsa-miR-369-3p	CLIP-seq
MIRT2306056	hsa-miR-371-5p	CLIP-seq
MIRT2306057	hsa-miR-371b-5p	CLIP-seq
MIRT1271123	hsa-miR-374a	CLIP-seq
MIRT1271124	hsa-miR-374b	CLIP-seq
MIRT1552664	hsa-miR-382	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271128	hsa-miR-3974	CLIP-seq
MIRT1271129	hsa-miR-4252	CLIP-seq
MIRT1271130	hsa-miR-429	CLIP-seq
MIRT1271131	hsa-miR-4327	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT2306058	hsa-miR-4420	CLIP-seq
MIRT1271133	hsa-miR-4422	CLIP-seq
MIRT1271134	hsa-miR-4433	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271136	hsa-miR-4459	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT2306059	hsa-miR-4493	CLIP-seq
MIRT2079743	hsa-miR-451b	CLIP-seq
MIRT2306060	hsa-miR-4522	CLIP-seq
MIRT1271139	hsa-miR-4537	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271141	hsa-miR-4683	CLIP-seq
MIRT2306061	hsa-miR-4703-3p	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT2079745	hsa-miR-4778-5p	CLIP-seq
MIRT1271145	hsa-miR-4793-3p	CLIP-seq
MIRT1271146	hsa-miR-4793-5p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271150	hsa-miR-508-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT2306062	hsa-miR-548a-5p	CLIP-seq
MIRT2306063	hsa-miR-548ab	CLIP-seq
MIRT2306064	hsa-miR-548ak	CLIP-seq
MIRT2306065	hsa-miR-548b-5p	CLIP-seq
MIRT2306066	hsa-miR-548c-5p	CLIP-seq
MIRT2306067	hsa-miR-548d-5p	CLIP-seq
MIRT2306068	hsa-miR-548h	CLIP-seq
MIRT2306069	hsa-miR-548i	CLIP-seq
MIRT2306070	hsa-miR-548j	CLIP-seq
MIRT2306071	hsa-miR-548k	CLIP-seq
MIRT2306072	hsa-miR-548l	CLIP-seq
MIRT2306073	hsa-miR-548w	CLIP-seq
MIRT2306074	hsa-miR-548y	CLIP-seq
MIRT2306075	hsa-miR-559	CLIP-seq
MIRT2306076	hsa-miR-579	CLIP-seq
MIRT2079747	hsa-miR-612	CLIP-seq
MIRT1271154	hsa-miR-624	CLIP-seq
MIRT2306077	hsa-miR-647	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT2079748	hsa-miR-661	CLIP-seq
MIRT1271158	hsa-miR-766	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT1552664	hsa-miR-382	CLIP-seq
MIRT2439625	hsa-miR-4633-3p	CLIP-seq
MIRT2439626	hsa-miR-4670-3p	CLIP-seq
MIRT2439627	hsa-miR-4760-3p	CLIP-seq
MIRT1552664	hsa-miR-382	CLIP-seq
MIRT2439625	hsa-miR-4633-3p	CLIP-seq
MIRT2439626	hsa-miR-4670-3p	CLIP-seq
MIRT2439627	hsa-miR-4760-3p	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271107	hsa-miR-1908	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT2306055	hsa-miR-3613-3p	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT2457365	hsa-miR-4684-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT2457366	hsa-miR-4764-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT2457367	hsa-miR-548c-3p	CLIP-seq
MIRT1271156	hsa-miR-663	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271110	hsa-miR-2114	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271152	hsa-miR-550a	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT2079739	hsa-miR-1285	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271107	hsa-miR-1908	CLIP-seq
MIRT1271110	hsa-miR-2114	CLIP-seq
MIRT2306053	hsa-miR-3120-5p	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT2079741	hsa-miR-3187-5p	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT2306055	hsa-miR-3613-3p	CLIP-seq
MIRT1271119	hsa-miR-3656	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT2306056	hsa-miR-371-5p	CLIP-seq
MIRT2306057	hsa-miR-371b-5p	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271128	hsa-miR-3974	CLIP-seq
MIRT1271129	hsa-miR-4252	CLIP-seq
MIRT2603347	hsa-miR-4263	CLIP-seq
MIRT2603348	hsa-miR-4311	CLIP-seq
MIRT1271131	hsa-miR-4327	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT2306058	hsa-miR-4420	CLIP-seq
MIRT1271133	hsa-miR-4422	CLIP-seq
MIRT1271134	hsa-miR-4433	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271136	hsa-miR-4459	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT2306059	hsa-miR-4493	CLIP-seq
MIRT2079743	hsa-miR-451b	CLIP-seq
MIRT2306060	hsa-miR-4522	CLIP-seq
MIRT1271139	hsa-miR-4537	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271141	hsa-miR-4683	CLIP-seq
MIRT2457365	hsa-miR-4684-5p	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT2457366	hsa-miR-4764-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT2079745	hsa-miR-4778-5p	CLIP-seq
MIRT1271145	hsa-miR-4793-3p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT2603349	hsa-miR-489	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271150	hsa-miR-508-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT2457367	hsa-miR-548c-3p	CLIP-seq
MIRT2603350	hsa-miR-548m	CLIP-seq
MIRT1271152	hsa-miR-550a	CLIP-seq
MIRT2603351	hsa-miR-576-5p	CLIP-seq
MIRT2079747	hsa-miR-612	CLIP-seq
MIRT1271154	hsa-miR-624	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT2079748	hsa-miR-661	CLIP-seq
MIRT1271156	hsa-miR-663	CLIP-seq
MIRT1271158	hsa-miR-766	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq
MIRT2079739	hsa-miR-1285	CLIP-seq
MIRT1271106	hsa-miR-1827	CLIP-seq
MIRT1271107	hsa-miR-1908	CLIP-seq
MIRT1271110	hsa-miR-2114	CLIP-seq
MIRT2306053	hsa-miR-3120-5p	CLIP-seq
MIRT1271112	hsa-miR-3122	CLIP-seq
MIRT2079741	hsa-miR-3187-5p	CLIP-seq
MIRT1271116	hsa-miR-3192	CLIP-seq
MIRT1271117	hsa-miR-3612	CLIP-seq
MIRT2306055	hsa-miR-3613-3p	CLIP-seq
MIRT1271119	hsa-miR-3656	CLIP-seq
MIRT1271120	hsa-miR-3689a-3p	CLIP-seq
MIRT1271121	hsa-miR-3689c	CLIP-seq
MIRT2306056	hsa-miR-371-5p	CLIP-seq
MIRT2306057	hsa-miR-371b-5p	CLIP-seq
MIRT1271125	hsa-miR-3913-5p	CLIP-seq
MIRT1271126	hsa-miR-3929	CLIP-seq
MIRT1271127	hsa-miR-3937	CLIP-seq
MIRT1271128	hsa-miR-3974	CLIP-seq
MIRT1271129	hsa-miR-4252	CLIP-seq
MIRT2603347	hsa-miR-4263	CLIP-seq
MIRT2603348	hsa-miR-4311	CLIP-seq
MIRT1271131	hsa-miR-4327	CLIP-seq
MIRT1271132	hsa-miR-4419b	CLIP-seq
MIRT2306058	hsa-miR-4420	CLIP-seq
MIRT1271133	hsa-miR-4422	CLIP-seq
MIRT1271134	hsa-miR-4433	CLIP-seq
MIRT1271135	hsa-miR-4457	CLIP-seq
MIRT1271136	hsa-miR-4459	CLIP-seq
MIRT1271137	hsa-miR-4478	CLIP-seq
MIRT2306059	hsa-miR-4493	CLIP-seq
MIRT2079743	hsa-miR-451b	CLIP-seq
MIRT2306060	hsa-miR-4522	CLIP-seq
MIRT1271140	hsa-miR-4649-3p	CLIP-seq
MIRT1271141	hsa-miR-4683	CLIP-seq
MIRT2457365	hsa-miR-4684-5p	CLIP-seq
MIRT1271142	hsa-miR-4722-5p	CLIP-seq
MIRT1271143	hsa-miR-4728-5p	CLIP-seq
MIRT2457366	hsa-miR-4764-5p	CLIP-seq
MIRT1271144	hsa-miR-4768-3p	CLIP-seq
MIRT2079745	hsa-miR-4778-5p	CLIP-seq
MIRT1271145	hsa-miR-4793-3p	CLIP-seq
MIRT1271148	hsa-miR-485-5p	CLIP-seq
MIRT2603349	hsa-miR-489	CLIP-seq
MIRT1271149	hsa-miR-490-3p	CLIP-seq
MIRT1271150	hsa-miR-508-5p	CLIP-seq
MIRT1271151	hsa-miR-513b	CLIP-seq
MIRT2457367	hsa-miR-548c-3p	CLIP-seq
MIRT2603350	hsa-miR-548m	CLIP-seq
MIRT1271152	hsa-miR-550a	CLIP-seq
MIRT2603351	hsa-miR-576-5p	CLIP-seq
MIRT2079747	hsa-miR-612	CLIP-seq
MIRT1271154	hsa-miR-624	CLIP-seq
MIRT1271155	hsa-miR-650	CLIP-seq
MIRT2079748	hsa-miR-661	CLIP-seq
MIRT1271156	hsa-miR-663	CLIP-seq
MIRT1271158	hsa-miR-766	CLIP-seq
MIRT1271159	hsa-miR-940	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IBA
GO:0000287	Function	Magnesium ion binding	IDA	15291819
GO:0001701	Process	In utero embryonic development	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006563	Process	L-serine metabolic process	IDA	15291819
GO:0006563	Process	L-serine metabolic process	TAS	9188776
GO:0006564	Process	L-serine biosynthetic process	IBA
GO:0006564	Process	L-serine biosynthetic process	IEA
GO:0006564	Process	L-serine biosynthetic process	IMP	14673469
GO:0008652	Process	Amino acid biosynthetic process	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0036424	Function	L-phosphoserine phosphatase activity	IBA
GO:0036424	Function	L-phosphoserine phosphatase activity	IDA	15291819
GO:0036424	Function	L-phosphoserine phosphatase activity	IEA
GO:0036424	Function	L-phosphoserine phosphatase activity	IMP	14673469
GO:0042802	Function	Identical protein binding	IPI	25416956, 25502805, 31515488
GO:0042803	Function	Protein homodimerization activity	IPI	12777757
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
172480	9577	ENSG00000146733

P78330

Protein name

Phosphoserine phosphatase (PSP) (PSPase) (EC 3.1.3.3) (L-3-phosphoserine phosphatase) (O-phosphoserine phosphohydrolase)

Protein function

Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine (PubMed:12213811, PubMed:14673469, PubMed:15291819, PubMed:25080166, PubMed:9222972). L-serine can t

PDB

1L8L , 1L8O , 1NNL , 6HYJ , 6HYY , 6Q6J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00702	Hydrolase	14 → 191		Domain

Sequence

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKA
ALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
SKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDG
ATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Sequence length

225

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Metabolic pathways Carbon metabolism Biosynthesis of amino acids		Serine biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Deficiency of phosphoserine phosphatase	Pathogenic; Likely pathogenic	rs786204793, rs104894036, rs1264747554, rs1788688718	RCV000169687 RCV000014594 RCV004799409 RCV001283838	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amelogenesis imperfecta	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMINO ACID METABOLISM, INBORN ERRORS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR TELANGIECTASIA TYPE 2	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurometabolic disorder due to serine deficiency	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSPH-related disorder	Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (95)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
3-phosphoserine phosphatase deficiency, infantile/juvenile form	3-phosphoserine phosphatase deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15154633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15727931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amino Acid Metabolism, Inborn Errors	Disorder of amino acid metabolism	CTD_human_DG	14673469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amino Acid Metabolism, Inherited Disorders	Inherited Errors of Amino Acid Metabolism	CTD_human_DG	14673469		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24069258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29419656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29419656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24979213, 25496516, 26109344, 29228969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25053597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30176945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25053597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	27277113	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31446747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27349874, 28476802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22276153, 24146633, 34201061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	14502653, 15641585, 28207803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of phosphoserine phosphatase	Deficiency Of Phosphoserine Phosphatase	UNIPROT_DG	14673469		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of phosphoserine phosphatase	Deficiency Of Phosphoserine Phosphatase	GENOMICS_ENGLAND_DG	14673469, 24816252, 25152457		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of phosphoserine phosphatase	Deficiency Of Phosphoserine Phosphatase	ORPHANET_DG	14673469		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of phosphoserine phosphatase	Deficiency Of Phosphoserine Phosphatase	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of phosphoserine phosphatase	Deficiency Of Phosphoserine Phosphatase	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	BEFREE	14502653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	15641585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28568564, 30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28568564, 30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29672864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	9573387		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	9573387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	24419221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	23254636, 24086739, 28501823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38098117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	37812589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29228969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31091873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37823569	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26916334, 28467028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	37812589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	15101498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31446747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23484134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15154633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26109344, 30240355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28500236	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15154633, 15727931, 24069258, 26109344		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28467028, 30726566		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEU-LAXOVA SYNDROME 1	Neu-Laxova Syndrome	GENOMICS_ENGLAND_DG	25152457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30977310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24419221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37533289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20083340, 27614955, 29157745, 29463454, 30068492, 31299107		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28150443, 28714593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	15154633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15641585, 24086739, 31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	24121548, 28500751, 30399478, 30955098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	14502653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	24419221, 25152457, 32077105, 37812589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	23254636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	14502653, 15101498, 16000317, 24121548, 27614955, 28467028, 28500751, 28951832, 29157745, 29463454, 29801913, 30068492, 30158953, 30399478, 30726566, 30955098, 31191295 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23484134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	28374985, 29705767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	28374985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31621373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20093640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20093640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28386166		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30398966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15154633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15154633, 34979926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	14502653, 15641585, 24086739, 28500751, 31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27277113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27277113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24390667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical supranuclear gaze palsy	Supranuclear gaze palsy	BEFREE	30068492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only

PSPH (phosphoserine phosphatase)