LYZL6 (lysozyme like 6)

Gene

• Entrez ID: 57151
• Gene name: Lysozyme like 6
• Gene symbol: LYZL6
• Synonyms (NCBI Gene): HEL-S-6a, LYC1, LYZB, PRO1485, TKAL754, UNQ754
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1124364	hsa-miR-1827	CLIP-seq
MIRT1124365	hsa-miR-2682	CLIP-seq
MIRT1124366	hsa-miR-3185	CLIP-seq
MIRT1124367	hsa-miR-3612	CLIP-seq
MIRT1124368	hsa-miR-3616-5p	CLIP-seq
MIRT1124369	hsa-miR-3647-5p	CLIP-seq
MIRT1124370	hsa-miR-4443	CLIP-seq
MIRT1124371	hsa-miR-4476	CLIP-seq
MIRT1124372	hsa-miR-449c	CLIP-seq
MIRT1124373	hsa-miR-4795-5p	CLIP-seq
MIRT1124374	hsa-miR-573	CLIP-seq
MIRT1124375	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0003796	Function	Lysozyme activity	IBA
GO:0003796	Function	Lysozyme activity	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005929	Component	Cilium	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IMP	24013621
GO:0009566	Process	Fertilization	IMP	28182716
GO:0009986	Component	Cell surface	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0036126	Component	Sperm flagellum	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IMP	24013621, 28182716
GO:0042995	Component	Cell projection	IEA
GO:0097225	Component	Sperm midpiece	IEA
GO:0097225	Component	Sperm midpiece	ISS
GO:0097524	Component	Sperm plasma membrane	IDA	28182716

Other IDs

• MIM: 612751
• HGNC: 29614
• e!Ensembl: ENSG00000275722

Protein

• UniProt ID: O75951
• Protein name: Lysozyme-like protein 6 (EC 3.2.1.17)
• Protein function: May be involved sperm-egg plasma membrane adhesion and fusion during fertilization (PubMed:28182716). Exhibits bacteriolytic activity in vitro against Micrococcus luteus and Staphylococcus aureus (PubMed:24013621, PubMed:28182716). Shows weak ba
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00062	Lys	20 → 145	C-type lysozyme/alpha-lactalbumin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis, epididymis and spermatozoa (at protein level) (PubMed:16014814, PubMed:28182716). Expressed in late-stage spermatocytes and round spermatids (PubMed:28182716). {ECO:0000269|PubMed:16014814, ECO:0000269|PubMed:28182
• Sequence:

  MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
  KINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA
  RGMNNWVEWRLHCSGRPLFYWLTGCRLR

• Sequence length: 148

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	35627192	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35627192	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	35627192	Associate	★☆☆☆☆ Found in Text Mining only