Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57118
Gene name	Calcium/calmodulin dependent protein kinase ID
Gene symbol	CAMK1D
Synonyms (NCBI Gene)	CKLiKCaM-K1CaMKID
Chromosome	10
Chromosome location	10p13
Summary	This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT618696	hsa-miR-562	HITS-CLIP	23824327
MIRT618695	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT618694	hsa-miR-5697	HITS-CLIP	23824327
MIRT618693	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT618692	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT618691	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT618690	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT618696	hsa-miR-562	HITS-CLIP	23824327
MIRT618695	hsa-miR-323a-3p	HITS-CLIP	23824327
MIRT618694	hsa-miR-5697	HITS-CLIP	23824327
MIRT618693	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT618692	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT618691	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT618690	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT860034	hsa-miR-150	CLIP-seq
MIRT860035	hsa-miR-1976	CLIP-seq
MIRT860036	hsa-miR-3130-3p	CLIP-seq
MIRT860037	hsa-miR-3147	CLIP-seq
MIRT860038	hsa-miR-4252	CLIP-seq
MIRT860039	hsa-miR-4425	CLIP-seq
MIRT860040	hsa-miR-4438	CLIP-seq
MIRT860041	hsa-miR-450b-3p	CLIP-seq
MIRT860042	hsa-miR-4690-3p	CLIP-seq
MIRT860043	hsa-miR-4722-3p	CLIP-seq
MIRT860044	hsa-miR-5095	CLIP-seq
MIRT860045	hsa-miR-520g	CLIP-seq
MIRT860046	hsa-miR-520h	CLIP-seq
MIRT860047	hsa-miR-769-3p	CLIP-seq
MIRT860048	hsa-miR-122	CLIP-seq
MIRT860049	hsa-miR-197	CLIP-seq
MIRT860035	hsa-miR-1976	CLIP-seq
MIRT860050	hsa-miR-2355-5p	CLIP-seq
MIRT860051	hsa-miR-2392	CLIP-seq
MIRT860052	hsa-miR-29a	CLIP-seq
MIRT860053	hsa-miR-29b	CLIP-seq
MIRT860054	hsa-miR-29c	CLIP-seq
MIRT860055	hsa-miR-3065-3p	CLIP-seq
MIRT860056	hsa-miR-3120-3p	CLIP-seq
MIRT860057	hsa-miR-3127-3p	CLIP-seq
MIRT860058	hsa-miR-3135b	CLIP-seq
MIRT860059	hsa-miR-3170	CLIP-seq
MIRT860060	hsa-miR-3187-3p	CLIP-seq
MIRT860061	hsa-miR-3194-3p	CLIP-seq
MIRT860062	hsa-miR-3652	CLIP-seq
MIRT860063	hsa-miR-411	CLIP-seq
MIRT860064	hsa-miR-4279	CLIP-seq
MIRT860065	hsa-miR-4283	CLIP-seq
MIRT860066	hsa-miR-431	CLIP-seq
MIRT860067	hsa-miR-4430	CLIP-seq
MIRT860068	hsa-miR-4435	CLIP-seq
MIRT860069	hsa-miR-4454	CLIP-seq
MIRT860070	hsa-miR-4489	CLIP-seq
MIRT860071	hsa-miR-4532	CLIP-seq
MIRT860072	hsa-miR-4695-3p	CLIP-seq
MIRT860073	hsa-miR-4696	CLIP-seq
MIRT860074	hsa-miR-4701-5p	CLIP-seq
MIRT860075	hsa-miR-4708-3p	CLIP-seq
MIRT860076	hsa-miR-4716-5p	CLIP-seq
MIRT860077	hsa-miR-4749-3p	CLIP-seq
MIRT860078	hsa-miR-4761-5p	CLIP-seq
MIRT860079	hsa-miR-4781-3p	CLIP-seq
MIRT860080	hsa-miR-4797-5p	CLIP-seq
MIRT860081	hsa-miR-498	CLIP-seq
MIRT860082	hsa-miR-5096	CLIP-seq
MIRT860083	hsa-miR-548s	CLIP-seq
MIRT860084	hsa-miR-564	CLIP-seq
MIRT860085	hsa-miR-582-5p	CLIP-seq
MIRT860086	hsa-miR-588	CLIP-seq
MIRT860087	hsa-miR-615-5p	CLIP-seq
MIRT860088	hsa-miR-720	CLIP-seq
MIRT860089	hsa-miR-924	CLIP-seq
MIRT860048	hsa-miR-122	CLIP-seq
MIRT1955222	hsa-miR-1297	CLIP-seq
MIRT1955223	hsa-miR-132	CLIP-seq
MIRT1955224	hsa-miR-1343	CLIP-seq
MIRT860034	hsa-miR-150	CLIP-seq
MIRT1955225	hsa-miR-1910	CLIP-seq
MIRT860035	hsa-miR-1976	CLIP-seq
MIRT1955226	hsa-miR-212	CLIP-seq
MIRT1955227	hsa-miR-26a	CLIP-seq
MIRT1955228	hsa-miR-26b	CLIP-seq
MIRT860058	hsa-miR-3135b	CLIP-seq
MIRT1955229	hsa-miR-3650	CLIP-seq
MIRT860062	hsa-miR-3652	CLIP-seq
MIRT1955230	hsa-miR-3907	CLIP-seq
MIRT860067	hsa-miR-4430	CLIP-seq
MIRT1955231	hsa-miR-4465	CLIP-seq
MIRT860072	hsa-miR-4695-3p	CLIP-seq
MIRT860043	hsa-miR-4722-3p	CLIP-seq
MIRT1955232	hsa-miR-516a-3p	CLIP-seq
MIRT860045	hsa-miR-520g	CLIP-seq
MIRT860046	hsa-miR-520h	CLIP-seq
MIRT860048	hsa-miR-122	CLIP-seq
MIRT2192941	hsa-miR-1227	CLIP-seq
MIRT860035	hsa-miR-1976	CLIP-seq
MIRT2192942	hsa-miR-2964a-3p	CLIP-seq
MIRT860058	hsa-miR-3135b	CLIP-seq
MIRT1955229	hsa-miR-3650	CLIP-seq
MIRT860062	hsa-miR-3652	CLIP-seq
MIRT2192943	hsa-miR-3934	CLIP-seq
MIRT860064	hsa-miR-4279	CLIP-seq
MIRT860067	hsa-miR-4430	CLIP-seq
MIRT860040	hsa-miR-4438	CLIP-seq
MIRT860069	hsa-miR-4454	CLIP-seq
MIRT860071	hsa-miR-4532	CLIP-seq
MIRT860072	hsa-miR-4695-3p	CLIP-seq
MIRT2192944	hsa-miR-4715-3p	CLIP-seq
MIRT860043	hsa-miR-4722-3p	CLIP-seq
MIRT2192945	hsa-miR-4731-5p	CLIP-seq
MIRT2192946	hsa-miR-4740-3p	CLIP-seq
MIRT2192947	hsa-miR-4772-3p	CLIP-seq
MIRT860081	hsa-miR-498	CLIP-seq
MIRT860044	hsa-miR-5095	CLIP-seq
MIRT2192948	hsa-miR-552	CLIP-seq
MIRT860084	hsa-miR-564	CLIP-seq
MIRT2192949	hsa-miR-616	CLIP-seq
MIRT2192950	hsa-miR-936	CLIP-seq
MIRT860048	hsa-miR-122	CLIP-seq
MIRT1955222	hsa-miR-1297	CLIP-seq
MIRT1955224	hsa-miR-1343	CLIP-seq
MIRT1955227	hsa-miR-26a	CLIP-seq
MIRT1955228	hsa-miR-26b	CLIP-seq
MIRT860058	hsa-miR-3135b	CLIP-seq
MIRT1955229	hsa-miR-3650	CLIP-seq
MIRT860062	hsa-miR-3652	CLIP-seq
MIRT860067	hsa-miR-4430	CLIP-seq
MIRT1955231	hsa-miR-4465	CLIP-seq
MIRT860072	hsa-miR-4695-3p	CLIP-seq
MIRT1955232	hsa-miR-516a-3p	CLIP-seq
MIRT2496002	hsa-miR-941	CLIP-seq
MIRT1955222	hsa-miR-1297	CLIP-seq
MIRT1955224	hsa-miR-1343	CLIP-seq
MIRT860035	hsa-miR-1976	CLIP-seq
MIRT1955227	hsa-miR-26a	CLIP-seq
MIRT1955228	hsa-miR-26b	CLIP-seq
MIRT860064	hsa-miR-4279	CLIP-seq
MIRT1955231	hsa-miR-4465	CLIP-seq
MIRT860043	hsa-miR-4722-3p	CLIP-seq
MIRT1955232	hsa-miR-516a-3p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IBA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IDA	11050006
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32707033, 33961781
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16324104
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11050006, 16324104
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0010975	Process	Regulation of neuron projection development	IBA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	IDA	16324104
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IMP	15840691
GO:0050773	Process	Regulation of dendrite development	IMP	17056143
GO:0060267	Process	Positive regulation of respiratory burst	IMP	15840691
GO:0071622	Process	Regulation of granulocyte chemotaxis	IBA
GO:0071622	Process	Regulation of granulocyte chemotaxis	IMP	15840691
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
607957	19341	ENSG00000183049

Q8IU85

Protein name

Calcium/calmodulin-dependent protein kinase type 1D (EC 2.7.11.17) (CaM kinase I delta) (CaM kinase ID) (CaM-KI delta) (CaMKI delta) (CaMKID) (CaMKI-like protein kinase) (CKLiK)

Protein function

Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, activates CREB-dependent gene transcription, regulates calcium-mediated granulocyte function and respirato

PDB

2JC6 , 6QP5 , 6T28 , 6T29 , 6T6F , 8BFM , 8BFS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	23 → 279	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly and mostly expressed in polymorphonuclear leukocytes (neutrophilic and eosinophilic granulocytes) while little or no expression is observed in monocytes and lymphocytes. {ECO:0000269|PubMed:11050006, ECO:000026

Sequence

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK

Sequence length

385

Interactions

View interactions

	KEGG
	Calcium signaling pathway Oxytocin signaling pathway Aldosterone synthesis and secretion Glioma

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMBLYOPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANAPHYLAXIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENIERE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESTIBULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29137392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19383354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19383354, 20418484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19383354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25366777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35246263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18567820, 24135527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18567820, 24135527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18567820, 19833888, 24135527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18567820, 19833888, 22923468, 23840313, 26599349, 27281091, 38353623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18567820, 19247373, 21909839, 22923468, 23840313, 25211022, 25839936, 28079868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	25410890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	28682143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34745571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26980576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	GWASCAT_DG	26980576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19383354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19383354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26599349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	34745571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19383354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18567820	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	34745571	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25366777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26851141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33243845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CAMK1D (calcium/calmodulin dependent protein kinase ID)