Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57113
Gene name	Transient receptor potential cation channel subfamily C member 7
Gene symbol	TRPC7
Synonyms (NCBI Gene)	TRP7
Chromosome	5
Chromosome location	5q31.1

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029163	hsa-miR-26b-5p	Microarray	19088304
MIRT1457288	hsa-miR-138	CLIP-seq
MIRT1457289	hsa-miR-224	CLIP-seq
MIRT1457290	hsa-miR-3529	CLIP-seq
MIRT1457291	hsa-miR-379	CLIP-seq
MIRT1457292	hsa-miR-4451	CLIP-seq
MIRT1457293	hsa-miR-4650-3p	CLIP-seq
MIRT2462418	hsa-miR-1587	CLIP-seq
MIRT2462419	hsa-miR-299-3p	CLIP-seq
MIRT2462420	hsa-miR-4265	CLIP-seq
MIRT2462421	hsa-miR-4296	CLIP-seq
MIRT2462422	hsa-miR-4322	CLIP-seq
MIRT2462423	hsa-miR-4417	CLIP-seq
MIRT2462424	hsa-miR-4492	CLIP-seq
MIRT2462425	hsa-miR-4498	CLIP-seq
MIRT2462426	hsa-miR-4656	CLIP-seq
MIRT2462427	hsa-miR-4675	CLIP-seq
MIRT2462428	hsa-miR-4741	CLIP-seq
MIRT2462429	hsa-miR-762	CLIP-seq
MIRT2462418	hsa-miR-1587	CLIP-seq
MIRT2462419	hsa-miR-299-3p	CLIP-seq
MIRT2462420	hsa-miR-4265	CLIP-seq
MIRT2462421	hsa-miR-4296	CLIP-seq
MIRT2462422	hsa-miR-4322	CLIP-seq
MIRT2462423	hsa-miR-4417	CLIP-seq
MIRT2462424	hsa-miR-4492	CLIP-seq
MIRT2462425	hsa-miR-4498	CLIP-seq
MIRT2462426	hsa-miR-4656	CLIP-seq
MIRT2462427	hsa-miR-4675	CLIP-seq
MIRT2462428	hsa-miR-4741	CLIP-seq
MIRT2462429	hsa-miR-762	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005262	Function	Calcium channel activity	TAS
GO:0005515	Function	Protein binding	IPI	21402151
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006828	Process	Manganese ion transport	IEA
GO:0007338	Process	Single fertilization	IBA
GO:0015279	Function	Store-operated calcium channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0070588	Process	Calcium ion transmembrane transport	TAS
GO:0070679	Function	Inositol 1,4,5 trisphosphate binding	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9HCX4

Protein name

Short transient receptor potential channel 7 (TrpC7) (Transient receptor protein 7) (TRP-7) (hTRP7)

Protein function

Forms a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	47 → 139	Ankyrin repeats (3 copies)	Repeat
PF08344	TRP_2	198 → 260	Transient receptor ion channel II	Family
PF00520	Ion_trans	386 → 684	Ion transport protein	Family

Sequence

MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVR
KMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVR
IVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIV
HILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVL
TALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVW
SDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSI
GLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNET
FTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLS
IFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNL
YSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTM
VVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYY
LIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
QKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQ
LSEKFGKNLNKDHLRVNKGKDI

Sequence length

862

Interactions

View interactions

	Reactome
			Effects of PIP2 hydrolysis Elevation of cytosolic Ca2+ levels TRP channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11690598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11690598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	11690598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	11690598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38320625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31881747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki syndrome	Kabuki syndrome	Pubtator	33674768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11690598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31755176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30786925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15685238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11690598		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRPC7 (transient receptor potential cation channel subfamily C member 7)