Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57111
Gene name	RAB25, member RAS oncogene family
Gene symbol	RAB25
Synonyms (NCBI Gene)	CATX-8RAB11C
Chromosome	1
Chromosome location	1q22
Summary	The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. T

285

Show/Hide all (285)

miRTarBase ID	miRNA	Experiments	Reference
MIRT499351	hsa-miR-583	PAR-CLIP	24398324
MIRT499350	hsa-miR-577	PAR-CLIP	24398324
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	24398324
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	24398324
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	24398324
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	24398324
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	24398324
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	24398324
MIRT499343	hsa-miR-4678	PAR-CLIP	24398324
MIRT499342	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499341	hsa-miR-4253	PAR-CLIP	24398324
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	24398324
MIRT499339	hsa-miR-8071	PAR-CLIP	24398324
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	24398324
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	24398324
MIRT499336	hsa-miR-3689e	PAR-CLIP	24398324
MIRT499335	hsa-miR-3689f	PAR-CLIP	24398324
MIRT499334	hsa-miR-3138	PAR-CLIP	24398324
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	24398324
MIRT499332	hsa-miR-8070	PAR-CLIP	24398324
MIRT499331	hsa-miR-758-3p	PAR-CLIP	24398324
MIRT499330	hsa-miR-548m	PAR-CLIP	24398324
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499334	hsa-miR-3138	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499336	hsa-miR-3689e	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499335	hsa-miR-3689f	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499341	hsa-miR-4253	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499343	hsa-miR-4678	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499330	hsa-miR-548m	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499350	hsa-miR-577	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499351	hsa-miR-583	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499331	hsa-miR-758-3p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499332	hsa-miR-8070	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499339	hsa-miR-8071	PAR-CLIP	26701625
MIRT499342	hsa-miR-202-3p	PAR-CLIP	27292025
MIRT499334	hsa-miR-3138	PAR-CLIP	27292025
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	27292025
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	27292025
MIRT499336	hsa-miR-3689e	PAR-CLIP	27292025
MIRT499335	hsa-miR-3689f	PAR-CLIP	27292025
MIRT499341	hsa-miR-4253	PAR-CLIP	27292025
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	27292025
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	27292025
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	27292025
MIRT499343	hsa-miR-4678	PAR-CLIP	27292025
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	27292025
MIRT499330	hsa-miR-548m	PAR-CLIP	27292025
MIRT499350	hsa-miR-577	PAR-CLIP	27292025
MIRT499351	hsa-miR-583	PAR-CLIP	27292025
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	27292025
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	27292025
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	27292025
MIRT499331	hsa-miR-758-3p	PAR-CLIP	27292025
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	27292025
MIRT499332	hsa-miR-8070	PAR-CLIP	27292025
MIRT499339	hsa-miR-8071	PAR-CLIP	27292025
MIRT735784	hsa-miR-140-3p	Luciferase reporter assayWestern blottingqRT-PCR	32114898
MIRT499351	hsa-miR-583	PAR-CLIP	24398324
MIRT499350	hsa-miR-577	PAR-CLIP	24398324
MIRT499349	hsa-miR-4436b-3p	PAR-CLIP	24398324
MIRT499348	hsa-miR-4632-5p	PAR-CLIP	24398324
MIRT499347	hsa-miR-6735-5p	PAR-CLIP	24398324
MIRT499346	hsa-miR-6879-5p	PAR-CLIP	24398324
MIRT499345	hsa-miR-7843-5p	PAR-CLIP	24398324
MIRT499344	hsa-miR-4761-3p	PAR-CLIP	24398324
MIRT499343	hsa-miR-4678	PAR-CLIP	24398324
MIRT499342	hsa-miR-202-3p	PAR-CLIP	24398324
MIRT499341	hsa-miR-4253	PAR-CLIP	24398324
MIRT499340	hsa-miR-6862-5p	PAR-CLIP	24398324
MIRT499339	hsa-miR-8071	PAR-CLIP	24398324
MIRT499338	hsa-miR-3689a-5p	PAR-CLIP	24398324
MIRT499337	hsa-miR-3689b-5p	PAR-CLIP	24398324
MIRT499336	hsa-miR-3689e	PAR-CLIP	24398324
MIRT499335	hsa-miR-3689f	PAR-CLIP	24398324
MIRT499334	hsa-miR-3138	PAR-CLIP	24398324
MIRT499333	hsa-miR-4520-3p	PAR-CLIP	24398324
MIRT499332	hsa-miR-8070	PAR-CLIP	24398324
MIRT499331	hsa-miR-758-3p	PAR-CLIP	24398324
MIRT499330	hsa-miR-548m	PAR-CLIP	24398324
MIRT1282936	hsa-miR-1294	CLIP-seq
MIRT1282937	hsa-miR-1304	CLIP-seq
MIRT1282938	hsa-miR-202	CLIP-seq
MIRT1282939	hsa-miR-3163	CLIP-seq
MIRT1282940	hsa-miR-3184	CLIP-seq
MIRT1282941	hsa-miR-3689b	CLIP-seq
MIRT1282942	hsa-miR-423-5p	CLIP-seq
MIRT1282943	hsa-miR-4316	CLIP-seq
MIRT1282944	hsa-miR-4520a-3p	CLIP-seq
MIRT1282945	hsa-miR-4651	CLIP-seq
MIRT1282946	hsa-miR-4677-3p	CLIP-seq
MIRT1282947	hsa-miR-4679	CLIP-seq
MIRT1282948	hsa-miR-608	CLIP-seq
MIRT1282949	hsa-miR-758	CLIP-seq
MIRT2083836	hsa-miR-1299	CLIP-seq
MIRT2083837	hsa-miR-132	CLIP-seq
MIRT2083838	hsa-miR-208a	CLIP-seq
MIRT2083839	hsa-miR-208b	CLIP-seq
MIRT2083840	hsa-miR-212	CLIP-seq
MIRT2083841	hsa-miR-3126-3p	CLIP-seq
MIRT2083842	hsa-miR-3667-5p	CLIP-seq
MIRT2083843	hsa-miR-499-5p	CLIP-seq
MIRT2083844	hsa-miR-622	CLIP-seq
MIRT2083845	hsa-miR-875-3p	CLIP-seq
MIRT2309029	hsa-miR-125a-5p	CLIP-seq
MIRT2309030	hsa-miR-125b	CLIP-seq
MIRT1282936	hsa-miR-1294	CLIP-seq
MIRT1282938	hsa-miR-202	CLIP-seq
MIRT1282940	hsa-miR-3184	CLIP-seq
MIRT1282941	hsa-miR-3689b	CLIP-seq
MIRT1282942	hsa-miR-423-5p	CLIP-seq
MIRT1282943	hsa-miR-4316	CLIP-seq
MIRT2309031	hsa-miR-4319	CLIP-seq
MIRT1282944	hsa-miR-4520a-3p	CLIP-seq
MIRT1282945	hsa-miR-4651	CLIP-seq
MIRT1282946	hsa-miR-4677-3p	CLIP-seq
MIRT1282947	hsa-miR-4679	CLIP-seq
MIRT2309032	hsa-miR-4725-5p	CLIP-seq
MIRT2309033	hsa-miR-504	CLIP-seq
MIRT2309034	hsa-miR-544b	CLIP-seq
MIRT1282948	hsa-miR-608	CLIP-seq
MIRT1282949	hsa-miR-758	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003382	Process	Epithelial cell morphogenesis	ISS
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003925	Function	G protein activity	ISS
GO:0005515	Function	Protein binding	IPI	17925226, 24955142, 26032412, 28017832, 32296183, 35512704
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15502842
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	22613965
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031143	Component	Pseudopodium	IDA	17925226
GO:0031260	Component	Pseudopodium membrane	IEA
GO:0031268	Process	Pseudopodium organization	IDA	17925226
GO:0031410	Component	Cytoplasmic vesicle	IDA	17925226, 22613965
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031489	Function	Myosin V binding	IPI	24006491
GO:0042995	Component	Cell projection	IEA
GO:0055037	Component	Recycling endosome	IBA
GO:0060627	Process	Regulation of vesicle-mediated transport	IMP	22613965
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
612942	18238	ENSG00000132698

P57735

Protein name

Ras-related protein Rab-25 (EC 3.6.5.2) (CATX-8)

Protein function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r

PDB

2OIL , 3TSO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	14 → 175	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expression is restricted to epithelial cells (PubMed:15502842). Expressed in ovarian epithelium (NOE) and breast tissue. Expressed in ovarian cancer; expression is increased relative to NOE cells. Expression in ovarian cancer is stage

Sequence

MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAA
VKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVV
MLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQ
RQNSIRTNAITLGSAQAGQEPGPGEKRACCISL

Sequence length

213

Interactions

View interactions

	Reactome
			RAB geranylgeranylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	20197623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23722651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19795443, 22644676, 26646320, 27259233, 29524309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22644676, 23139263, 26646320, 29524309, 33507713, 36360219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20376596	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	19623182	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12450215, 26692100	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23722651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24658031, 27792477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32759795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29079774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37562257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15502842, 17393986, 19623182, 22940905, 25405658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23345591, 29515334, 8360141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29024942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23345591, 38131227	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25686498, 28612496, 29079774, 31570754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17393986, 25405658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28038427, 30551439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28281975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28281975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23340300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	22644676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23340300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26692100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22644676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22644676	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27379752	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23340300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15502842, 19795443, 22644676, 22692575, 23139263, 26646320, 27259233, 29524309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24658031, 27792477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23340300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17393986, 19623182, 22940905, 25405658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28400705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23722651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17393986, 19719478, 22644676, 22940905, 23176489, 25339198, 26535714, 26692100, 27259233, 28400705, 28939823, 28969096, 29371698, 30232331, 30445998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23345591, 29515334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37562257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17393986, 17943972, 19719478, 19795443, 20197623, 22197222, 22253197, 22991305, 23176489, 23340300, 23345591, 24403269, 26692100, 27259233, 27379752 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26535714		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17393986, 19623182, 22940905, 25405658		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17393986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19623182, 22174824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34321959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	22786590	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28400705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33015770	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25686498, 31570754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22991305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24403269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27379752	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	27379752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	31144312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23340300, 24403269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19795443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32975231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RAB25 (RAB25, member RAS oncogene family)