Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57107
Gene name	Decaprenyl diphosphate synthase subunit 2
Gene symbol	PDSS2
Synonyms (NCBI Gene)	C6orf210COQ10D3COQ1BDLP1bA59I9.3hDLP1
Chromosome	6
Chromosome location	6q21
Summary	The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isope

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs35555197	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, genic downstream transcript variant
rs118203955	G>A,C	Pathogenic	Intron variant, genic downstream transcript variant, stop gained, missense variant, coding sequence variant
rs118203956	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs143549737	T>G	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs782439454	CT>-	Likely-pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs863224166	T>C	Pathogenic	Intron variant, genic downstream transcript variant, splice acceptor variant
rs863224167	T>C	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, intron variant, missense variant

486

Show/Hide all (486)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029379	hsa-miR-26b-5p	Microarray	19088304
MIRT440010	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440010	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT1223407	hsa-miR-1252	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT1223409	hsa-miR-19a	CLIP-seq
MIRT1223410	hsa-miR-19b	CLIP-seq
MIRT1223411	hsa-miR-216a	CLIP-seq
MIRT1223412	hsa-miR-24	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT1223414	hsa-miR-3164	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT1223417	hsa-miR-3646	CLIP-seq
MIRT1223418	hsa-miR-3674	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT1223422	hsa-miR-3929	CLIP-seq
MIRT1223423	hsa-miR-4267	CLIP-seq
MIRT1223424	hsa-miR-4274	CLIP-seq
MIRT1223425	hsa-miR-4284	CLIP-seq
MIRT1223426	hsa-miR-4419b	CLIP-seq
MIRT1223427	hsa-miR-4422	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223429	hsa-miR-4478	CLIP-seq
MIRT1223430	hsa-miR-4509	CLIP-seq
MIRT1223431	hsa-miR-4519	CLIP-seq
MIRT1223432	hsa-miR-4649-3p	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT1223434	hsa-miR-4708-3p	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT1223437	hsa-miR-4735-5p	CLIP-seq
MIRT1223438	hsa-miR-4744	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT1223440	hsa-miR-4775	CLIP-seq
MIRT1223441	hsa-miR-485-5p	CLIP-seq
MIRT1223442	hsa-miR-550a	CLIP-seq
MIRT1223443	hsa-miR-576-5p	CLIP-seq
MIRT1223444	hsa-miR-590-3p	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT1223447	hsa-miR-764	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq
MIRT2065012	hsa-miR-1251	CLIP-seq
MIRT2065013	hsa-miR-1323	CLIP-seq
MIRT2065014	hsa-miR-140-3p	CLIP-seq
MIRT2065015	hsa-miR-149	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT2065016	hsa-miR-1972	CLIP-seq
MIRT1223411	hsa-miR-216a	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT2065017	hsa-miR-3148	CLIP-seq
MIRT2065018	hsa-miR-3158-3p	CLIP-seq
MIRT2065019	hsa-miR-3174	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT2065020	hsa-miR-3622a-3p	CLIP-seq
MIRT2065021	hsa-miR-3622b-3p	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT2065022	hsa-miR-3925-3p	CLIP-seq
MIRT1223422	hsa-miR-3929	CLIP-seq
MIRT2065023	hsa-miR-423-3p	CLIP-seq
MIRT1223423	hsa-miR-4267	CLIP-seq
MIRT2065024	hsa-miR-4282	CLIP-seq
MIRT2065025	hsa-miR-4292	CLIP-seq
MIRT2065026	hsa-miR-4293	CLIP-seq
MIRT2065027	hsa-miR-4303	CLIP-seq
MIRT2065028	hsa-miR-4308	CLIP-seq
MIRT1223426	hsa-miR-4419b	CLIP-seq
MIRT2065029	hsa-miR-4433	CLIP-seq
MIRT2065030	hsa-miR-4446-3p	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223429	hsa-miR-4478	CLIP-seq
MIRT1223432	hsa-miR-4649-3p	CLIP-seq
MIRT2065031	hsa-miR-4675	CLIP-seq
MIRT2065032	hsa-miR-4690-5p	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT2065033	hsa-miR-4717-5p	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT2065034	hsa-miR-4741	CLIP-seq
MIRT2065035	hsa-miR-4746-5p	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT1223441	hsa-miR-485-5p	CLIP-seq
MIRT2065036	hsa-miR-489	CLIP-seq
MIRT2065037	hsa-miR-514	CLIP-seq
MIRT2065038	hsa-miR-514b-3p	CLIP-seq
MIRT2065039	hsa-miR-544b	CLIP-seq
MIRT2065040	hsa-miR-548a-3p	CLIP-seq
MIRT2065041	hsa-miR-548aa	CLIP-seq
MIRT2065042	hsa-miR-548ac	CLIP-seq
MIRT2065043	hsa-miR-548d-3p	CLIP-seq
MIRT2065044	hsa-miR-548e	CLIP-seq
MIRT2065045	hsa-miR-548f	CLIP-seq
MIRT2065046	hsa-miR-548o	CLIP-seq
MIRT2065047	hsa-miR-548z	CLIP-seq
MIRT1223442	hsa-miR-550a	CLIP-seq
MIRT2065048	hsa-miR-566	CLIP-seq
MIRT2065049	hsa-miR-596	CLIP-seq
MIRT2065050	hsa-miR-626	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT2065051	hsa-miR-661	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT2065052	hsa-miR-766	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT1223411	hsa-miR-216a	CLIP-seq
MIRT1223412	hsa-miR-24	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT2065019	hsa-miR-3174	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT2065020	hsa-miR-3622a-3p	CLIP-seq
MIRT2065021	hsa-miR-3622b-3p	CLIP-seq
MIRT2293001	hsa-miR-3665	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT2293002	hsa-miR-3912	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT1223422	hsa-miR-3929	CLIP-seq
MIRT2293003	hsa-miR-3937	CLIP-seq
MIRT1223423	hsa-miR-4267	CLIP-seq
MIRT2293004	hsa-miR-4276	CLIP-seq
MIRT2065026	hsa-miR-4293	CLIP-seq
MIRT1223426	hsa-miR-4419b	CLIP-seq
MIRT1223427	hsa-miR-4422	CLIP-seq
MIRT2065029	hsa-miR-4433	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223429	hsa-miR-4478	CLIP-seq
MIRT1223432	hsa-miR-4649-3p	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT1223441	hsa-miR-485-5p	CLIP-seq
MIRT2293005	hsa-miR-542-3p	CLIP-seq
MIRT2065039	hsa-miR-544b	CLIP-seq
MIRT1223442	hsa-miR-550a	CLIP-seq
MIRT2065049	hsa-miR-596	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT1223447	hsa-miR-764	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq
MIRT2065013	hsa-miR-1323	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT2065019	hsa-miR-3174	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT2065020	hsa-miR-3622a-3p	CLIP-seq
MIRT2065021	hsa-miR-3622b-3p	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT2293003	hsa-miR-3937	CLIP-seq
MIRT2065029	hsa-miR-4433	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT2065039	hsa-miR-544b	CLIP-seq
MIRT2065046	hsa-miR-548o	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq
MIRT2456179	hsa-miR-3675-3p	CLIP-seq
MIRT2456180	hsa-miR-4662a-5p	CLIP-seq
MIRT2456181	hsa-miR-4676-5p	CLIP-seq
MIRT2456182	hsa-miR-4684-5p	CLIP-seq
MIRT2456183	hsa-miR-4755-3p	CLIP-seq
MIRT2456184	hsa-miR-548c-3p	CLIP-seq
MIRT2456185	hsa-miR-575	CLIP-seq
MIRT2591022	hsa-miR-1184	CLIP-seq
MIRT2591023	hsa-miR-1207-5p	CLIP-seq
MIRT2591024	hsa-miR-1245b-5p	CLIP-seq
MIRT2065012	hsa-miR-1251	CLIP-seq
MIRT2591025	hsa-miR-1273e	CLIP-seq
MIRT2591026	hsa-miR-1275	CLIP-seq
MIRT2591027	hsa-miR-1285	CLIP-seq
MIRT2591028	hsa-miR-1291	CLIP-seq
MIRT2591029	hsa-miR-1301	CLIP-seq
MIRT2065013	hsa-miR-1323	CLIP-seq
MIRT2065014	hsa-miR-140-3p	CLIP-seq
MIRT2065015	hsa-miR-149	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT2591030	hsa-miR-1911	CLIP-seq
MIRT2591031	hsa-miR-192	CLIP-seq
MIRT2065016	hsa-miR-1972	CLIP-seq
MIRT2591032	hsa-miR-2115	CLIP-seq
MIRT2591033	hsa-miR-2117	CLIP-seq
MIRT2591034	hsa-miR-215	CLIP-seq
MIRT2591035	hsa-miR-2355-3p	CLIP-seq
MIRT2591036	hsa-miR-25	CLIP-seq
MIRT2591037	hsa-miR-296-5p	CLIP-seq
MIRT2591038	hsa-miR-3064-3p	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT2591039	hsa-miR-3130-3p	CLIP-seq
MIRT2591040	hsa-miR-3142	CLIP-seq
MIRT2591041	hsa-miR-3145-3p	CLIP-seq
MIRT2591042	hsa-miR-3147	CLIP-seq
MIRT2065017	hsa-miR-3148	CLIP-seq
MIRT2065018	hsa-miR-3158-3p	CLIP-seq
MIRT2591043	hsa-miR-3163	CLIP-seq
MIRT2065019	hsa-miR-3174	CLIP-seq
MIRT2591044	hsa-miR-3183	CLIP-seq
MIRT2591045	hsa-miR-3187-5p	CLIP-seq
MIRT2591046	hsa-miR-32	CLIP-seq
MIRT2591047	hsa-miR-338-5p	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT2065020	hsa-miR-3622a-3p	CLIP-seq
MIRT2065021	hsa-miR-3622b-3p	CLIP-seq
MIRT2591048	hsa-miR-363	CLIP-seq
MIRT1223417	hsa-miR-3646	CLIP-seq
MIRT2591049	hsa-miR-3662	CLIP-seq
MIRT2293001	hsa-miR-3665	CLIP-seq
MIRT2591050	hsa-miR-367	CLIP-seq
MIRT1223418	hsa-miR-3674	CLIP-seq
MIRT2456179	hsa-miR-3675-3p	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT2591051	hsa-miR-3689a-5p	CLIP-seq
MIRT2591052	hsa-miR-3689b	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT2591053	hsa-miR-3689e	CLIP-seq
MIRT2591054	hsa-miR-3689f	CLIP-seq
MIRT2591055	hsa-miR-369-3p	CLIP-seq
MIRT2591056	hsa-miR-374a	CLIP-seq
MIRT2591057	hsa-miR-374b	CLIP-seq
MIRT2591058	hsa-miR-374c	CLIP-seq
MIRT2591059	hsa-miR-3908	CLIP-seq
MIRT2591060	hsa-miR-3909	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT1223422	hsa-miR-3929	CLIP-seq
MIRT2293003	hsa-miR-3937	CLIP-seq
MIRT2591061	hsa-miR-3942-5p	CLIP-seq
MIRT2591062	hsa-miR-3973	CLIP-seq
MIRT2065023	hsa-miR-423-3p	CLIP-seq
MIRT2591063	hsa-miR-4255	CLIP-seq
MIRT2591064	hsa-miR-4260	CLIP-seq
MIRT1223423	hsa-miR-4267	CLIP-seq
MIRT2591065	hsa-miR-4273	CLIP-seq
MIRT1223424	hsa-miR-4274	CLIP-seq
MIRT2065025	hsa-miR-4292	CLIP-seq
MIRT2065028	hsa-miR-4308	CLIP-seq
MIRT2591066	hsa-miR-4325	CLIP-seq
MIRT1223426	hsa-miR-4419b	CLIP-seq
MIRT1223427	hsa-miR-4422	CLIP-seq
MIRT2591067	hsa-miR-4425	CLIP-seq
MIRT2065029	hsa-miR-4433	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223429	hsa-miR-4478	CLIP-seq
MIRT1223431	hsa-miR-4519	CLIP-seq
MIRT2591068	hsa-miR-4525	CLIP-seq
MIRT2591069	hsa-miR-4633-5p	CLIP-seq
MIRT2591070	hsa-miR-4646-3p	CLIP-seq
MIRT1223432	hsa-miR-4649-3p	CLIP-seq
MIRT2591071	hsa-miR-4659a-3p	CLIP-seq
MIRT2591072	hsa-miR-4659b-3p	CLIP-seq
MIRT2591073	hsa-miR-4660	CLIP-seq
MIRT2456180	hsa-miR-4662a-5p	CLIP-seq
MIRT2591074	hsa-miR-4665-5p	CLIP-seq
MIRT2591075	hsa-miR-4666-3p	CLIP-seq
MIRT2456181	hsa-miR-4676-5p	CLIP-seq
MIRT2456182	hsa-miR-4684-5p	CLIP-seq
MIRT2065032	hsa-miR-4690-5p	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT2591076	hsa-miR-4703-5p	CLIP-seq
MIRT2065033	hsa-miR-4717-5p	CLIP-seq
MIRT2591077	hsa-miR-4721	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT2591078	hsa-miR-4723-3p	CLIP-seq
MIRT2591079	hsa-miR-4723-5p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT2591080	hsa-miR-4729	CLIP-seq
MIRT1223437	hsa-miR-4735-5p	CLIP-seq
MIRT2591081	hsa-miR-4736	CLIP-seq
MIRT2591082	hsa-miR-4738-3p	CLIP-seq
MIRT2065035	hsa-miR-4746-5p	CLIP-seq
MIRT2591083	hsa-miR-4753-3p	CLIP-seq
MIRT2456183	hsa-miR-4755-3p	CLIP-seq
MIRT2591084	hsa-miR-4763-3p	CLIP-seq
MIRT2591085	hsa-miR-4766-3p	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT2591086	hsa-miR-4773	CLIP-seq
MIRT1223440	hsa-miR-4775	CLIP-seq
MIRT2591087	hsa-miR-4781-3p	CLIP-seq
MIRT1223441	hsa-miR-485-5p	CLIP-seq
MIRT2591088	hsa-miR-5047	CLIP-seq
MIRT2591089	hsa-miR-508-5p	CLIP-seq
MIRT2591090	hsa-miR-520d-5p	CLIP-seq
MIRT2591091	hsa-miR-522	CLIP-seq
MIRT2591092	hsa-miR-524-5p	CLIP-seq
MIRT2591093	hsa-miR-532-5p	CLIP-seq
MIRT2065039	hsa-miR-544b	CLIP-seq
MIRT2065040	hsa-miR-548a-3p	CLIP-seq
MIRT2591094	hsa-miR-548a-5p	CLIP-seq
MIRT2065041	hsa-miR-548aa	CLIP-seq
MIRT2591095	hsa-miR-548ab	CLIP-seq
MIRT2065042	hsa-miR-548ac	CLIP-seq
MIRT2591096	hsa-miR-548ak	CLIP-seq
MIRT2591097	hsa-miR-548b-5p	CLIP-seq
MIRT2456184	hsa-miR-548c-3p	CLIP-seq
MIRT2591098	hsa-miR-548c-5p	CLIP-seq
MIRT2065043	hsa-miR-548d-3p	CLIP-seq
MIRT2591099	hsa-miR-548d-5p	CLIP-seq
MIRT2065044	hsa-miR-548e	CLIP-seq
MIRT2065045	hsa-miR-548f	CLIP-seq
MIRT2591100	hsa-miR-548g	CLIP-seq
MIRT2591101	hsa-miR-548h	CLIP-seq
MIRT2591102	hsa-miR-548i	CLIP-seq
MIRT2591103	hsa-miR-548j	CLIP-seq
MIRT2591104	hsa-miR-548k	CLIP-seq
MIRT2591105	hsa-miR-548l	CLIP-seq
MIRT2065046	hsa-miR-548o	CLIP-seq
MIRT2591106	hsa-miR-548w	CLIP-seq
MIRT2591107	hsa-miR-548y	CLIP-seq
MIRT2065047	hsa-miR-548z	CLIP-seq
MIRT1223442	hsa-miR-550a	CLIP-seq
MIRT2591108	hsa-miR-559	CLIP-seq
MIRT2065048	hsa-miR-566	CLIP-seq
MIRT2591109	hsa-miR-570	CLIP-seq
MIRT2456185	hsa-miR-575	CLIP-seq
MIRT1223443	hsa-miR-576-5p	CLIP-seq
MIRT2591110	hsa-miR-584	CLIP-seq
MIRT1223444	hsa-miR-590-3p	CLIP-seq
MIRT2591111	hsa-miR-607	CLIP-seq
MIRT2591112	hsa-miR-612	CLIP-seq
MIRT2591113	hsa-miR-625	CLIP-seq
MIRT2591114	hsa-miR-655	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT2065051	hsa-miR-661	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT2591115	hsa-miR-676	CLIP-seq
MIRT1223447	hsa-miR-764	CLIP-seq
MIRT2065052	hsa-miR-766	CLIP-seq
MIRT2591116	hsa-miR-767-5p	CLIP-seq
MIRT2591117	hsa-miR-92a	CLIP-seq
MIRT2591118	hsa-miR-92b	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq
MIRT2591022	hsa-miR-1184	CLIP-seq
MIRT2591023	hsa-miR-1207-5p	CLIP-seq
MIRT2591024	hsa-miR-1245b-5p	CLIP-seq
MIRT2065012	hsa-miR-1251	CLIP-seq
MIRT2591025	hsa-miR-1273e	CLIP-seq
MIRT2591027	hsa-miR-1285	CLIP-seq
MIRT2591028	hsa-miR-1291	CLIP-seq
MIRT2591029	hsa-miR-1301	CLIP-seq
MIRT2065013	hsa-miR-1323	CLIP-seq
MIRT2065014	hsa-miR-140-3p	CLIP-seq
MIRT2065015	hsa-miR-149	CLIP-seq
MIRT1223408	hsa-miR-1827	CLIP-seq
MIRT2591031	hsa-miR-192	CLIP-seq
MIRT2065016	hsa-miR-1972	CLIP-seq
MIRT2591032	hsa-miR-2115	CLIP-seq
MIRT2591033	hsa-miR-2117	CLIP-seq
MIRT2591034	hsa-miR-215	CLIP-seq
MIRT2591035	hsa-miR-2355-3p	CLIP-seq
MIRT2591036	hsa-miR-25	CLIP-seq
MIRT2591037	hsa-miR-296-5p	CLIP-seq
MIRT2591038	hsa-miR-3064-3p	CLIP-seq
MIRT1223413	hsa-miR-3122	CLIP-seq
MIRT2591039	hsa-miR-3130-3p	CLIP-seq
MIRT2591040	hsa-miR-3142	CLIP-seq
MIRT2591042	hsa-miR-3147	CLIP-seq
MIRT2065017	hsa-miR-3148	CLIP-seq
MIRT2591043	hsa-miR-3163	CLIP-seq
MIRT2065019	hsa-miR-3174	CLIP-seq
MIRT2591044	hsa-miR-3183	CLIP-seq
MIRT2591045	hsa-miR-3187-5p	CLIP-seq
MIRT2687538	hsa-miR-3190	CLIP-seq
MIRT2591046	hsa-miR-32	CLIP-seq
MIRT2687539	hsa-miR-335	CLIP-seq
MIRT1223415	hsa-miR-34b	CLIP-seq
MIRT1223416	hsa-miR-3614-5p	CLIP-seq
MIRT2065020	hsa-miR-3622a-3p	CLIP-seq
MIRT2065021	hsa-miR-3622b-3p	CLIP-seq
MIRT2591048	hsa-miR-363	CLIP-seq
MIRT1223417	hsa-miR-3646	CLIP-seq
MIRT2591049	hsa-miR-3662	CLIP-seq
MIRT2293001	hsa-miR-3665	CLIP-seq
MIRT2591050	hsa-miR-367	CLIP-seq
MIRT1223418	hsa-miR-3674	CLIP-seq
MIRT2456179	hsa-miR-3675-3p	CLIP-seq
MIRT1223419	hsa-miR-3689a-3p	CLIP-seq
MIRT1223420	hsa-miR-3689c	CLIP-seq
MIRT2591060	hsa-miR-3909	CLIP-seq
MIRT1223421	hsa-miR-3913-5p	CLIP-seq
MIRT1223422	hsa-miR-3929	CLIP-seq
MIRT2293003	hsa-miR-3937	CLIP-seq
MIRT2591062	hsa-miR-3973	CLIP-seq
MIRT2591063	hsa-miR-4255	CLIP-seq
MIRT1223423	hsa-miR-4267	CLIP-seq
MIRT2591065	hsa-miR-4273	CLIP-seq
MIRT1223424	hsa-miR-4274	CLIP-seq
MIRT2065025	hsa-miR-4292	CLIP-seq
MIRT2065028	hsa-miR-4308	CLIP-seq
MIRT2591066	hsa-miR-4325	CLIP-seq
MIRT1223426	hsa-miR-4419b	CLIP-seq
MIRT1223427	hsa-miR-4422	CLIP-seq
MIRT2591067	hsa-miR-4425	CLIP-seq
MIRT1223428	hsa-miR-4459	CLIP-seq
MIRT1223429	hsa-miR-4478	CLIP-seq
MIRT1223431	hsa-miR-4519	CLIP-seq
MIRT2591069	hsa-miR-4633-5p	CLIP-seq
MIRT2591070	hsa-miR-4646-3p	CLIP-seq
MIRT1223432	hsa-miR-4649-3p	CLIP-seq
MIRT2591071	hsa-miR-4659a-3p	CLIP-seq
MIRT2591072	hsa-miR-4659b-3p	CLIP-seq
MIRT2591073	hsa-miR-4660	CLIP-seq
MIRT2456180	hsa-miR-4662a-5p	CLIP-seq
MIRT2456181	hsa-miR-4676-5p	CLIP-seq
MIRT2456182	hsa-miR-4684-5p	CLIP-seq
MIRT2065032	hsa-miR-4690-5p	CLIP-seq
MIRT1223433	hsa-miR-4695-5p	CLIP-seq
MIRT2065033	hsa-miR-4717-5p	CLIP-seq
MIRT1223435	hsa-miR-4722-5p	CLIP-seq
MIRT2591078	hsa-miR-4723-3p	CLIP-seq
MIRT1223436	hsa-miR-4728-5p	CLIP-seq
MIRT1223437	hsa-miR-4735-5p	CLIP-seq
MIRT2591081	hsa-miR-4736	CLIP-seq
MIRT2591082	hsa-miR-4738-3p	CLIP-seq
MIRT2687540	hsa-miR-4752	CLIP-seq
MIRT2591083	hsa-miR-4753-3p	CLIP-seq
MIRT2456183	hsa-miR-4755-3p	CLIP-seq
MIRT2591084	hsa-miR-4763-3p	CLIP-seq
MIRT1223439	hsa-miR-4768-3p	CLIP-seq
MIRT2591086	hsa-miR-4773	CLIP-seq
MIRT1223440	hsa-miR-4775	CLIP-seq
MIRT2591087	hsa-miR-4781-3p	CLIP-seq
MIRT1223441	hsa-miR-485-5p	CLIP-seq
MIRT2591088	hsa-miR-5047	CLIP-seq
MIRT2591089	hsa-miR-508-5p	CLIP-seq
MIRT2591090	hsa-miR-520d-5p	CLIP-seq
MIRT2591091	hsa-miR-522	CLIP-seq
MIRT2591092	hsa-miR-524-5p	CLIP-seq
MIRT2591093	hsa-miR-532-5p	CLIP-seq
MIRT2065039	hsa-miR-544b	CLIP-seq
MIRT2065040	hsa-miR-548a-3p	CLIP-seq
MIRT2591094	hsa-miR-548a-5p	CLIP-seq
MIRT2065041	hsa-miR-548aa	CLIP-seq
MIRT2591095	hsa-miR-548ab	CLIP-seq
MIRT2065042	hsa-miR-548ac	CLIP-seq
MIRT2591096	hsa-miR-548ak	CLIP-seq
MIRT2591097	hsa-miR-548b-5p	CLIP-seq
MIRT2456184	hsa-miR-548c-3p	CLIP-seq
MIRT2591098	hsa-miR-548c-5p	CLIP-seq
MIRT2065043	hsa-miR-548d-3p	CLIP-seq
MIRT2591099	hsa-miR-548d-5p	CLIP-seq
MIRT2065044	hsa-miR-548e	CLIP-seq
MIRT2065045	hsa-miR-548f	CLIP-seq
MIRT2591100	hsa-miR-548g	CLIP-seq
MIRT2591101	hsa-miR-548h	CLIP-seq
MIRT2591102	hsa-miR-548i	CLIP-seq
MIRT2591103	hsa-miR-548j	CLIP-seq
MIRT2591104	hsa-miR-548k	CLIP-seq
MIRT2591105	hsa-miR-548l	CLIP-seq
MIRT2065046	hsa-miR-548o	CLIP-seq
MIRT2591106	hsa-miR-548w	CLIP-seq
MIRT2591107	hsa-miR-548y	CLIP-seq
MIRT2065047	hsa-miR-548z	CLIP-seq
MIRT1223442	hsa-miR-550a	CLIP-seq
MIRT2591108	hsa-miR-559	CLIP-seq
MIRT2065048	hsa-miR-566	CLIP-seq
MIRT2591109	hsa-miR-570	CLIP-seq
MIRT2456185	hsa-miR-575	CLIP-seq
MIRT1223443	hsa-miR-576-5p	CLIP-seq
MIRT2591110	hsa-miR-584	CLIP-seq
MIRT1223444	hsa-miR-590-3p	CLIP-seq
MIRT2591111	hsa-miR-607	CLIP-seq
MIRT2591112	hsa-miR-612	CLIP-seq
MIRT2687541	hsa-miR-617	CLIP-seq
MIRT1223445	hsa-miR-658	CLIP-seq
MIRT2065051	hsa-miR-661	CLIP-seq
MIRT1223446	hsa-miR-665	CLIP-seq
MIRT2591115	hsa-miR-676	CLIP-seq
MIRT1223447	hsa-miR-764	CLIP-seq
MIRT2065052	hsa-miR-766	CLIP-seq
MIRT2591116	hsa-miR-767-5p	CLIP-seq
MIRT2591117	hsa-miR-92a	CLIP-seq
MIRT2591118	hsa-miR-92b	CLIP-seq
MIRT1223448	hsa-miR-940	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004659	Function	Prenyltransferase activity	IBA
GO:0004659	Function	Prenyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16262699
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006744	Process	Ubiquinone biosynthetic process	IBA
GO:0006744	Process	Ubiquinone biosynthetic process	IDA	16262699
GO:0006744	Process	Ubiquinone biosynthetic process	IEA
GO:0008299	Process	Isoprenoid biosynthetic process	IBA
GO:0008299	Process	Isoprenoid biosynthetic process	IDA	16262699
GO:0008299	Process	Isoprenoid biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0021549	Process	Cerebellum development	ISS
GO:0032476	Component	Polyprenyl diphosphate synthase complex	IBA
GO:0032478	Component	Heterotetrameric polyprenyl diphosphate synthase complex	IDA	16262699
GO:0032478	Component	Heterotetrameric polyprenyl diphosphate synthase complex	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050878	Process	Regulation of body fluid levels	IEA
GO:0052923	Function	All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) activity	IEA
GO:0097269	Function	All-trans-decaprenyl-diphosphate synthase activity	IDA	16262699
GO:0097269	Function	All-trans-decaprenyl-diphosphate synthase activity	IEA
GO:0110142	Component	Ubiquinone biosynthesis complex	IEA
GO:1990234	Component	Transferase complex	IEA

MIM	HGNC	e!Ensembl
610564	23041	ENSG00000164494

Q86YH6

Protein name

All trans-polyprenyl-diphosphate synthase PDSS2 (All-trans-decaprenyl-diphosphate synthase subunit 2) (EC 2.5.1.91) (Candidate tumor suppressor protein) (Decaprenyl pyrophosphate synthase subunit 2) (Decaprenyl-diphosphate synthase subunit 2) (Solanesyl-d

Protein function

Heterotetrameric enzyme that catalyzes the condensation of farnesyl diphosphate (FPP), which acts as a primer, and isopentenyl diphosphate (IPP) to produce prenyl diphosphates of varying chain lengths and participates in the determination of the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00348	polyprenyl_synt	106 → 316	Polyprenyl synthetase	Domain

Sequence

MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIV
GYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLIS
KAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITD
DIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF
IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTS
AIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

Sequence length

399

Interactions

View interactions

	KEGG		Reactome
	Terpenoid backbone biosynthesis		Ubiquinol biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Coenzyme Q10 deficiency, primary, 3	Likely pathogenic; Pathogenic	rs1782160930, rs118203955	RCV005037749 RCV000001259	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Coenzyme Q10 deficiency	Uncertain significance; Likely benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney disorder	Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIGH SYNDROME	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIGH SYNDROME WITH NEPHROTIC SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PDSS2-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (56)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Akinesia	Akinesia	BEFREE	30167934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25780306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23312889, 24608273, 31783675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	19096106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	25514360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25189544		★★★★★ ★☆☆☆☆ Found in Text Mining only
COENZYME Q10 DEFICIENCY	Coenzyme Q10 Deficiency	BEFREE	17186472, 29032433		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coenzyme Q10 Deficiency	Coenzyme q10 deficiency	Pubtator	17186472	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coenzyme Q10 Deficiency	Coenzyme q10 deficiency	Pubtator	19096106	Stimulate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
COENZYME Q10 DEFICIENCY, PRIMARY, 3	Coenzyme Q10 Deficiency	GENOMICS_ENGLAND_DG	17186472, 18437205, 27604308		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COENZYME Q10 DEFICIENCY, PRIMARY, 3	Coenzyme Q10 Deficiency	UNIPROT_DG	17186472		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COENZYME Q10 DEFICIENCY, PRIMARY, 3	Coenzyme Q10 Deficiency	CLINVAR_DG	17374725		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COENZYME Q10 DEFICIENCY, PRIMARY, 3	Coenzyme Q10 Deficiency	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congestive heart failure	Congestive Heart Failure	BEFREE	30567380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29221444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse mesangial sclerosis (disorder)	Mesangial sclerosis	BEFREE	29032433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	30731467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	28847794, 30731467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial hematuria	Hematuria	BEFREE	29138824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	23926186		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Generalized tonic-clonic seizures with focal onset	Bilateral convulsive seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	23926186, 29138824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30567380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17186472, 26041819		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	17186472	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leigh Disease	Leigh Syndrome	BEFREE	17186472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	17186472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	GENOMICS_ENGLAND_DG	18437205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh syndrome with nephrotic syndrome	Leigh Syndrome With Nephrotic Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	25189544, 25780306, 29967258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25189544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31783675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25330808	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23312889, 24608273, 31783675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25330808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19209031, 25780306, 29967258		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19188149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	28847794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19188149, 23312889, 24608273, 25189544, 25330808, 25780306, 29967258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	17186472	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29032433		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nocturia	Nocturia	BEFREE	30572329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23312889, 24608273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21615675, 25482923, 28040727, 28424899, 28847794, 29121638, 29215823, 29322594, 29432463, 29896152, 30099246, 30167934, 30314921, 30731467, 31040814, 31372031, 31438888, 31831791 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	16054567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30731467, 31372031, 31812923, 31831791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25330808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25330808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDSS2 (decaprenyl diphosphate synthase subunit 2)