Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57105
Gene name	Cysteinyl leukotriene receptor 2
Gene symbol	CYSLTR2
Synonyms (NCBI Gene)	CYSLT2CYSLT2RGPCR21HG57HPN321KPG_011PSEC0146hGPCR21
Chromosome	13
Chromosome location	13q14.2
Summary	The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT719246	hsa-miR-3714	HITS-CLIP	19536157
MIRT719245	hsa-miR-9500	HITS-CLIP	19536157
MIRT719244	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT719243	hsa-miR-4469	HITS-CLIP	19536157
MIRT719242	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT719241	hsa-miR-4287	HITS-CLIP	19536157
MIRT719240	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT719239	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT719238	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT719237	hsa-miR-107	HITS-CLIP	19536157
MIRT719236	hsa-miR-4747-5p	HITS-CLIP	19536157
MIRT719235	hsa-miR-5196-5p	HITS-CLIP	19536157
MIRT719234	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT659192	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT659191	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659190	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT668798	hsa-miR-1248	HITS-CLIP	23824327
MIRT659189	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT659188	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT659187	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT668797	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT668796	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT659192	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT659191	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659190	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT659189	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT659188	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT659187	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT719246	hsa-miR-3714	HITS-CLIP	19536157
MIRT719245	hsa-miR-9500	HITS-CLIP	19536157
MIRT719244	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT719243	hsa-miR-4469	HITS-CLIP	19536157
MIRT719242	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT719241	hsa-miR-4287	HITS-CLIP	19536157
MIRT719240	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT719239	hsa-miR-605-3p	HITS-CLIP	19536157
MIRT719238	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT719237	hsa-miR-107	HITS-CLIP	19536157
MIRT719236	hsa-miR-4747-5p	HITS-CLIP	19536157
MIRT719235	hsa-miR-5196-5p	HITS-CLIP	19536157
MIRT719234	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT659192	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT659191	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659190	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT668798	hsa-miR-1248	HITS-CLIP	23824327
MIRT659189	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT659188	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT659187	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT668797	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT668796	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT659192	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT659191	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT659190	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT659189	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT659188	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT659187	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT922064	hsa-miR-1284	CLIP-seq
MIRT922065	hsa-miR-145	CLIP-seq
MIRT922066	hsa-miR-204	CLIP-seq
MIRT922067	hsa-miR-211	CLIP-seq
MIRT922068	hsa-miR-2115	CLIP-seq
MIRT922069	hsa-miR-3124-3p	CLIP-seq
MIRT922070	hsa-miR-3145-5p	CLIP-seq
MIRT922071	hsa-miR-3194-3p	CLIP-seq
MIRT922072	hsa-miR-326	CLIP-seq
MIRT922073	hsa-miR-330-5p	CLIP-seq
MIRT922074	hsa-miR-3685	CLIP-seq
MIRT922075	hsa-miR-384	CLIP-seq
MIRT922076	hsa-miR-4283	CLIP-seq
MIRT922077	hsa-miR-4436b-3p	CLIP-seq
MIRT922078	hsa-miR-4446-5p	CLIP-seq
MIRT922079	hsa-miR-4489	CLIP-seq
MIRT922080	hsa-miR-4658	CLIP-seq
MIRT922081	hsa-miR-4667-5p	CLIP-seq
MIRT922082	hsa-miR-4700-5p	CLIP-seq
MIRT922083	hsa-miR-4712-5p	CLIP-seq
MIRT922084	hsa-miR-4731-3p	CLIP-seq
MIRT922085	hsa-miR-4755-5p	CLIP-seq
MIRT922086	hsa-miR-4758-5p	CLIP-seq
MIRT922087	hsa-miR-4761-3p	CLIP-seq
MIRT922088	hsa-miR-4780	CLIP-seq
MIRT922089	hsa-miR-4789-5p	CLIP-seq
MIRT922090	hsa-miR-4801	CLIP-seq
MIRT922091	hsa-miR-508-5p	CLIP-seq
MIRT922092	hsa-miR-544	CLIP-seq
MIRT922093	hsa-miR-579	CLIP-seq
MIRT922094	hsa-miR-623	CLIP-seq
MIRT922095	hsa-miR-637	CLIP-seq
MIRT922096	hsa-miR-767-3p	CLIP-seq
MIRT922097	hsa-miR-770-5p	CLIP-seq
MIRT1973120	hsa-miR-1237	CLIP-seq
MIRT1973121	hsa-miR-4713-5p	CLIP-seq
MIRT1973122	hsa-miR-874	CLIP-seq
MIRT2208779	hsa-miR-128	CLIP-seq
MIRT2208780	hsa-miR-27a	CLIP-seq
MIRT2208781	hsa-miR-27b	CLIP-seq
MIRT2208782	hsa-miR-3145-3p	CLIP-seq
MIRT2208783	hsa-miR-3157-5p	CLIP-seq
MIRT2208784	hsa-miR-3614-3p	CLIP-seq
MIRT2208785	hsa-miR-3667-3p	CLIP-seq
MIRT2208786	hsa-miR-4297	CLIP-seq
MIRT2208787	hsa-miR-4474-5p	CLIP-seq
MIRT2208788	hsa-miR-4690-3p	CLIP-seq
MIRT2208789	hsa-miR-5096	CLIP-seq
MIRT2208790	hsa-miR-513a-5p	CLIP-seq
MIRT2447951	hsa-miR-2110	CLIP-seq
MIRT2447952	hsa-miR-3135b	CLIP-seq
MIRT2447953	hsa-miR-320e	CLIP-seq
MIRT2447954	hsa-miR-4271	CLIP-seq
MIRT2447955	hsa-miR-4300	CLIP-seq
MIRT2447956	hsa-miR-4434	CLIP-seq
MIRT2447957	hsa-miR-4487	CLIP-seq
MIRT2447958	hsa-miR-4516	CLIP-seq
MIRT2447959	hsa-miR-4531	CLIP-seq
MIRT922081	hsa-miR-4667-5p	CLIP-seq
MIRT922082	hsa-miR-4700-5p	CLIP-seq
MIRT2447960	hsa-miR-4725-3p	CLIP-seq
MIRT2447961	hsa-miR-4731-5p	CLIP-seq
MIRT2447962	hsa-miR-920	CLIP-seq
MIRT2447963	hsa-miR-939	CLIP-seq
MIRT2679008	hsa-miR-3065-5p	CLIP-seq
MIRT2679009	hsa-miR-3647-3p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001631	Function	Cysteinyl leukotriene receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0004974	Function	Leukotriene receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	NAS	10913337
GO:0005515	Function	Protein binding	IPI	21525870, 24550280, 26617989, 30126976, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	NAS	10913337
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0061737	Process	Leukotriene signaling pathway	IEA

MIM	HGNC	e!Ensembl
605666	18274	ENSG00000152207

Q9NS75

Protein name

Cysteinyl leukotriene receptor 2 (CysLTR2) (G-protein coupled receptor GPCR21) (hGPCR21) (G-protein coupled receptor HG57) (HPN321)

Protein function

Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	55 → 305	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in the heart, placenta, spleen, peripheral blood leukocytes and adrenal gland. In lung, expressed in the interstitial macrophages, and slightly in smooth muscle cells.

Sequence

MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV

Sequence length

346

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Glucagon signaling in metabolic regulation Leukotriene receptors G alpha (q) signalling events G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production LTC4-CYSLTR mediated IL4 production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA	—	CTD, Orphanet CTD, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (54)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	15328359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11696047, 14515063, 15454733, 15475736, 15970796, 17154652, 19665766, 19840403, 21596548, 26433531, 31126515		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	13679572, 26433531	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15454733, 17460547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	BEFREE	16502481		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	CTD_human_DG	16502481, 20485159		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	24253666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20824707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27475906	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24253666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21936770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	15696087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28402256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22194989, 23829413, 35401882, 36834820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital lamellar cataract	Congenital Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27475906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27475906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27475906	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inferior lens subluxation	Inferior lens subluxation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28623130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	ORPHANET_DG	27089179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of choroid	Choroidal melanoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of ciliary body	Ciliary body melanoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of iris	Iris melanoma	ORPHANET_DG	27089179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant melanoma of iris	Iris melanoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20824707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27475906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28402256		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27150534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33588787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29226425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35689754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24253666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16689996, 22123288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16689996	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20824707, 27934878, 28402256, 31162285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus, Blue	Blue Nevus	BEFREE	27934878, 31162285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35401882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	15328359		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiration Disorders	Respiration Disorders	BEFREE	19665766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	19665766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	22634478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27475906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	22123288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27089179, 31614358, 31671564		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	CTD_human_DG	27089179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	ORPHANET_DG	27089179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	27934878, 31227497, 32415113, 33229459, 33288675, 33348918, 33588787	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular System Injuries	Vascular system injury	Pubtator	16606835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CYSLTR2 (cysteinyl leukotriene receptor 2)