Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57103
Gene name	TP53 induced glycolysis regulatory phosphatase
Gene symbol	TIGAR
Synonyms (NCBI Gene)	C12orf5FR2BP
Chromosome	12
Chromosome location	12p13.32
Summary	This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and

104

Show/Hide all (104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720045	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT720044	hsa-miR-193a-3p	HITS-CLIP	19536157
MIRT041240	hsa-miR-193b-3p	HITS-CLIP	19536157
MIRT720043	hsa-miR-1285-5p	HITS-CLIP	19536157
MIRT720042	hsa-miR-3614-5p	HITS-CLIP	19536157
MIRT720041	hsa-miR-6500-3p	HITS-CLIP	19536157
MIRT720040	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT720039	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT720038	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT720037	hsa-miR-3926	HITS-CLIP	19536157
MIRT720036	hsa-miR-4642	HITS-CLIP	19536157
MIRT720035	hsa-miR-548s	HITS-CLIP	19536157
MIRT660060	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT660059	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT660058	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT660057	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT660056	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT660055	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT660054	hsa-miR-8063	HITS-CLIP	23824327
MIRT273070	hsa-miR-4698	HITS-CLIP	23824327
MIRT660052	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT660053	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT660051	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT660050	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT660049	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT660048	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT660047	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT564571	hsa-miR-302f	PAR-CLIP	20371350
MIRT524679	hsa-miR-4740-3p	PAR-CLIP	20371350
MIRT564570	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT524678	hsa-miR-6134	PAR-CLIP	20371350
MIRT524672	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT524671	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT564569	hsa-miR-1273e	PAR-CLIP	20371350
MIRT540968	hsa-miR-122-3p	PAR-CLIP	21572407
MIRT524679	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT524678	hsa-miR-6134	PAR-CLIP	23446348
MIRT524677	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT524676	hsa-miR-6086	PAR-CLIP	23446348
MIRT524675	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT524674	hsa-miR-3689d	PAR-CLIP	23446348
MIRT524673	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT524672	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT524671	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT524670	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT524669	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT754592	hsa-miR-3689d	PAR-CLIP	27292025
MIRT754589	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT754594	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT754042	hsa-miR-4740-3p	PAR-CLIP	27292025
MIRT754590	hsa-miR-6086	PAR-CLIP	27292025
MIRT754044	hsa-miR-6134	PAR-CLIP	27292025
MIRT754591	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT754595	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT754593	hsa-miR-6851-5p	PAR-CLIP	27292025
MIRT754045	hsa-miR-6880-5p	PAR-CLIP	27292025
MIRT754046	hsa-miR-7847-3p	PAR-CLIP	27292025
MIRT733382	hsa-miR-146a-5p	ELISALuciferase reporter assayqRT-PCRWestern blotting	33935653
MIRT740425	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT740426	hsa-miR-193a-3p	HITS-CLIP	19536157
MIRT740427	hsa-miR-193b-3p	HITS-CLIP	19536157
MIRT740428	hsa-miR-1285-5p	HITS-CLIP	19536157
MIRT740429	hsa-miR-3614-5p	HITS-CLIP	19536157
MIRT740430	hsa-miR-6500-3p	HITS-CLIP	19536157
MIRT740431	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT740432	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT740433	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT740434	hsa-miR-3926	HITS-CLIP	19536157
MIRT740435	hsa-miR-4642	HITS-CLIP	19536157
MIRT740436	hsa-miR-548s	HITS-CLIP	19536157
MIRT741894	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT741895	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT741896	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT741897	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT741898	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT741899	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT741900	hsa-miR-8063	HITS-CLIP	23824327
MIRT273070	hsa-miR-4698	HITS-CLIP	23824327
MIRT741901	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT741902	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT741903	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT741904	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT741905	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT741906	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT741907	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT754041	hsa-miR-302f	PAR-CLIP	20371350
MIRT754042	hsa-miR-4740-3p	PAR-CLIP	20371350
MIRT754043	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT754044	hsa-miR-6134	PAR-CLIP	20371350
MIRT754045	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT754046	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT754047	hsa-miR-1273e	PAR-CLIP	20371350
MIRT754413	hsa-miR-122-3p	PAR-CLIP	21572407
MIRT754042	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT754044	hsa-miR-6134	PAR-CLIP	23446348
MIRT754589	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT754590	hsa-miR-6086	PAR-CLIP	23446348
MIRT754591	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT754592	hsa-miR-3689d	PAR-CLIP	23446348
MIRT754593	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT754045	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT754046	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT754594	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT754595	hsa-miR-6516-5p	PAR-CLIP	23446348

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000423	Process	Mitophagy	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0003824	Function	Catalytic activity	IEA
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	EXP	16839880
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IBA
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IDA	19015259
GO:0004331	Function	Fructose-2,6-bisphosphate 2-phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	23185017, 32814053
GO:0005634	Component	Nucleus	IDA	25928429
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	23185017, 25928429
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	23185017
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006003	Process	Fructose 2,6-bisphosphate metabolic process	IEA
GO:0006096	Process	Glycolytic process	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006974	Process	DNA damage response	IDA	25928429
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019661	Process	Glucose catabolic process to lactate via pyruvate	IEA
GO:0043067	Process	Regulation of programmed cell death	IEA
GO:0043069	Process	Negative regulation of programmed cell death	IDA	23185017
GO:0043456	Process	Regulation of pentose-phosphate shunt	IBA
GO:0043456	Process	Regulation of pentose-phosphate shunt	IEA
GO:0043456	Process	Regulation of pentose-phosphate shunt	IMP	25928429
GO:0045739	Process	Positive regulation of DNA repair	IMP	25928429
GO:0045820	Process	Negative regulation of glycolytic process	IBA
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045937	Process	Positive regulation of phosphate metabolic process	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0071279	Process	Cellular response to cobalt ion	IDA	25928429
GO:0071456	Process	Cellular response to hypoxia	IDA	23185017
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:1901525	Process	Negative regulation of mitophagy	IEA
GO:1902153	Process	Regulation of response to DNA damage checkpoint signaling	IMP	25928429
GO:1903301	Process	Positive regulation of hexokinase activity	IDA	23185017
GO:1904024	Process	Negative regulation of glucose catabolic process to lactate via pyruvate	IEA
GO:1905857	Process	Positive regulation of pentose-phosphate shunt	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
610775	1185	ENSG00000078237

Q9NQ88

Protein name

Fructose-2,6-bisphosphatase TIGAR (EC 3.1.3.46) (TP53-induced glycolysis and apoptosis regulator) (TP53-induced glycolysis regulatory phosphatase)

Protein function

Fructose-bisphosphatase hydrolyzing fructose-2,6-bisphosphate as well as fructose-1,6-bisphosphate (PubMed:19015259). Acts as a negative regulator of glycolysis by lowering intracellular levels of fructose-2,6-bisphosphate in a p53/TP53-dependen

PDB

3DCY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00300	His_Phos_1	6 → 150	Histidine phosphatase superfamily (branch 1)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain (PubMed:22887998). Expressed in breast tumors (PubMed:21820150). Expressed in glioblastomas (PubMed:22887998). {ECO:0000269|PubMed:21820150, ECO:0000269|PubMed:22887998}.

Sequence

MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM
RTKQTMHGILERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPP
GGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKV
NSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFII
NFEEGREVKPTVQCICMNLQDHLNGLTETR

Sequence length

270

Interactions

View interactions

	KEGG		Reactome
	Fructose and mannose metabolism Metabolic pathways Central carbon metabolism in cancer		TP53 Regulates Metabolic Genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27884166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute recurrent pancreatitis	Pancreatitis	BEFREE	31166201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29634976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	29462755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28774732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26647977, 27803158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23817040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29753331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31983610, 32049042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28823591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28600657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29331305, 30978385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37878531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18945750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27693855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	23726973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26675982, 30636898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26675982, 30418550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28138701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	23861893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	23861893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31160088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30977208		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30977208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21864926, 22887998, 23640457, 31402948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21864926, 23640457, 31402948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21864926, 22887998, 23640457, 26631910, 28338004, 30823646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28776759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31317559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	23726973		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27884166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27884166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30267647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	30267647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23612020, 23817040, 30710454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23612020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24363807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29777913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28729399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21761199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29753331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25661349, 31799200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23726973, 25928429, 29769743, 30284488, 31402948, 31799200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	30267647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30519107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22782351, 24240177, 26675982, 28338004, 28774732, 29777913, 30823646, 31799200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30267647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29753331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29776966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	31166201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31983610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	17943404, 31166201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28600657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30267647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30267647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	23861893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22782351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23861893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30523643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25661349, 31799200		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29777913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23726973		★★★★★ ★☆☆☆☆ Found in Text Mining only

TIGAR (TP53 induced glycolysis regulatory phosphatase)