Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57045
Gene name	Twisted gastrulation BMP signaling modulator 1
Gene symbol	TWSG1
Synonyms (NCBI Gene)	TSG
Chromosome	18
Chromosome location	18p11.22

339

Show/Hide all (339)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022445	hsa-miR-124-3p	Microarray	18668037
MIRT040515	hsa-miR-577	CLASH	23622248
MIRT664755	hsa-miR-21-3p	HITS-CLIP	23824327
MIRT664754	hsa-miR-3591-3p	HITS-CLIP	23824327
MIRT649724	hsa-miR-892b	HITS-CLIP	23824327
MIRT649723	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT649722	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649721	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649720	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT649719	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT649718	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649717	hsa-miR-4284	HITS-CLIP	23824327
MIRT649716	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649715	hsa-miR-4291	HITS-CLIP	23824327
MIRT649724	hsa-miR-892b	HITS-CLIP	23824327
MIRT649723	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT649722	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649721	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649720	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT649719	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT649718	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649717	hsa-miR-4284	HITS-CLIP	23824327
MIRT649716	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649715	hsa-miR-4291	HITS-CLIP	23824327
MIRT149046	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT149068	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT149046	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT149068	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT664755	hsa-miR-21-3p	HITS-CLIP	23824327
MIRT664754	hsa-miR-3591-3p	HITS-CLIP	23824327
MIRT649724	hsa-miR-892b	HITS-CLIP	23824327
MIRT649723	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT649722	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649721	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649720	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT649719	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT649718	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649717	hsa-miR-4284	HITS-CLIP	23824327
MIRT649716	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649715	hsa-miR-4291	HITS-CLIP	23824327
MIRT649724	hsa-miR-892b	HITS-CLIP	23824327
MIRT649723	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT649722	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649721	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649720	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT649719	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT649718	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649717	hsa-miR-4284	HITS-CLIP	23824327
MIRT649716	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649715	hsa-miR-4291	HITS-CLIP	23824327
MIRT756000	hsa-miR-136-5p	Luciferase reporter assayWestern blottingqRT-PCR	35958507
MIRT1464553	hsa-miR-103a	CLIP-seq
MIRT1464554	hsa-miR-107	CLIP-seq
MIRT1464555	hsa-miR-1184	CLIP-seq
MIRT1464556	hsa-miR-1263	CLIP-seq
MIRT1464557	hsa-miR-128	CLIP-seq
MIRT1464558	hsa-miR-139-5p	CLIP-seq
MIRT1464559	hsa-miR-214	CLIP-seq
MIRT1464560	hsa-miR-219-1-3p	CLIP-seq
MIRT1464561	hsa-miR-224	CLIP-seq
MIRT1464562	hsa-miR-23a	CLIP-seq
MIRT1464563	hsa-miR-23b	CLIP-seq
MIRT1464564	hsa-miR-23c	CLIP-seq
MIRT1464565	hsa-miR-27a	CLIP-seq
MIRT1464566	hsa-miR-27b	CLIP-seq
MIRT1464567	hsa-miR-3120-5p	CLIP-seq
MIRT1464568	hsa-miR-3136-5p	CLIP-seq
MIRT1464569	hsa-miR-3137	CLIP-seq
MIRT1464570	hsa-miR-3158-5p	CLIP-seq
MIRT1464571	hsa-miR-3160-5p	CLIP-seq
MIRT1464572	hsa-miR-3163	CLIP-seq
MIRT1464573	hsa-miR-3180-5p	CLIP-seq
MIRT1464574	hsa-miR-3185	CLIP-seq
MIRT1464575	hsa-miR-320e	CLIP-seq
MIRT1464576	hsa-miR-340	CLIP-seq
MIRT1464577	hsa-miR-3545-3p	CLIP-seq
MIRT1464578	hsa-miR-3619-5p	CLIP-seq
MIRT1464579	hsa-miR-3662	CLIP-seq
MIRT1464580	hsa-miR-3671	CLIP-seq
MIRT1464581	hsa-miR-3686	CLIP-seq
MIRT1464582	hsa-miR-409-3p	CLIP-seq
MIRT1464583	hsa-miR-4418	CLIP-seq
MIRT1464584	hsa-miR-4428	CLIP-seq
MIRT1464585	hsa-miR-4439	CLIP-seq
MIRT1464586	hsa-miR-4494	CLIP-seq
MIRT1464587	hsa-miR-4496	CLIP-seq
MIRT1464588	hsa-miR-4509	CLIP-seq
MIRT1464589	hsa-miR-4513	CLIP-seq
MIRT1464590	hsa-miR-4652-3p	CLIP-seq
MIRT1464591	hsa-miR-4722-5p	CLIP-seq
MIRT1464592	hsa-miR-4744	CLIP-seq
MIRT1464593	hsa-miR-4760-3p	CLIP-seq
MIRT1464594	hsa-miR-4768-3p	CLIP-seq
MIRT1464595	hsa-miR-4778-5p	CLIP-seq
MIRT1464596	hsa-miR-483-3p	CLIP-seq
MIRT1464597	hsa-miR-499-3p	CLIP-seq
MIRT1464598	hsa-miR-499a-3p	CLIP-seq
MIRT1464599	hsa-miR-499a-5p	CLIP-seq
MIRT1464600	hsa-miR-509-3-5p	CLIP-seq
MIRT1464601	hsa-miR-509-5p	CLIP-seq
MIRT1464602	hsa-miR-520a-5p	CLIP-seq
MIRT1464603	hsa-miR-525-5p	CLIP-seq
MIRT1464604	hsa-miR-548ac	CLIP-seq
MIRT1464605	hsa-miR-548ae	CLIP-seq
MIRT1464606	hsa-miR-548aj	CLIP-seq
MIRT1464607	hsa-miR-548am	CLIP-seq
MIRT1464608	hsa-miR-548d-3p	CLIP-seq
MIRT1464609	hsa-miR-548x	CLIP-seq
MIRT1464610	hsa-miR-548z	CLIP-seq
MIRT1464611	hsa-miR-561	CLIP-seq
MIRT1464612	hsa-miR-761	CLIP-seq
MIRT1464613	hsa-miR-922	CLIP-seq
MIRT1464572	hsa-miR-3163	CLIP-seq
MIRT1464576	hsa-miR-340	CLIP-seq
MIRT2139726	hsa-miR-124	CLIP-seq
MIRT2139727	hsa-miR-1264	CLIP-seq
MIRT2139728	hsa-miR-1305	CLIP-seq
MIRT2139729	hsa-miR-132	CLIP-seq
MIRT2139730	hsa-miR-148a	CLIP-seq
MIRT2139731	hsa-miR-148b	CLIP-seq
MIRT2139732	hsa-miR-152	CLIP-seq
MIRT2139733	hsa-miR-212	CLIP-seq
MIRT2139734	hsa-miR-3115	CLIP-seq
MIRT2139735	hsa-miR-3133	CLIP-seq
MIRT2139736	hsa-miR-3150a-5p	CLIP-seq
MIRT2139737	hsa-miR-3150b-5p	CLIP-seq
MIRT2139738	hsa-miR-3179	CLIP-seq
MIRT1464574	hsa-miR-3185	CLIP-seq
MIRT2139739	hsa-miR-3675-5p	CLIP-seq
MIRT2139740	hsa-miR-3922-5p	CLIP-seq
MIRT2139741	hsa-miR-4282	CLIP-seq
MIRT2139742	hsa-miR-4307	CLIP-seq
MIRT2139743	hsa-miR-4421	CLIP-seq
MIRT2139744	hsa-miR-4422	CLIP-seq
MIRT2139745	hsa-miR-4519	CLIP-seq
MIRT2139746	hsa-miR-4528	CLIP-seq
MIRT2139747	hsa-miR-4530	CLIP-seq
MIRT2139748	hsa-miR-4666-3p	CLIP-seq
MIRT2139749	hsa-miR-498	CLIP-seq
MIRT2139750	hsa-miR-506	CLIP-seq
MIRT2139751	hsa-miR-513a-3p	CLIP-seq
MIRT2139752	hsa-miR-590-3p	CLIP-seq
MIRT2139753	hsa-miR-634	CLIP-seq
MIRT1464553	hsa-miR-103a	CLIP-seq
MIRT1464554	hsa-miR-107	CLIP-seq
MIRT1464555	hsa-miR-1184	CLIP-seq
MIRT2360285	hsa-miR-1276	CLIP-seq
MIRT1464557	hsa-miR-128	CLIP-seq
MIRT2360286	hsa-miR-142-5p	CLIP-seq
MIRT2360287	hsa-miR-202	CLIP-seq
MIRT1464559	hsa-miR-214	CLIP-seq
MIRT1464560	hsa-miR-219-1-3p	CLIP-seq
MIRT1464565	hsa-miR-27a	CLIP-seq
MIRT1464566	hsa-miR-27b	CLIP-seq
MIRT1464568	hsa-miR-3136-5p	CLIP-seq
MIRT1464572	hsa-miR-3163	CLIP-seq
MIRT1464573	hsa-miR-3180-5p	CLIP-seq
MIRT2360288	hsa-miR-320a	CLIP-seq
MIRT2360289	hsa-miR-320b	CLIP-seq
MIRT2360290	hsa-miR-320c	CLIP-seq
MIRT2360291	hsa-miR-320d	CLIP-seq
MIRT1464576	hsa-miR-340	CLIP-seq
MIRT1464577	hsa-miR-3545-3p	CLIP-seq
MIRT1464578	hsa-miR-3619-5p	CLIP-seq
MIRT2360292	hsa-miR-3653	CLIP-seq
MIRT2360293	hsa-miR-3658	CLIP-seq
MIRT1464580	hsa-miR-3671	CLIP-seq
MIRT2360294	hsa-miR-410	CLIP-seq
MIRT2360295	hsa-miR-4311	CLIP-seq
MIRT2360296	hsa-miR-4320	CLIP-seq
MIRT1464583	hsa-miR-4418	CLIP-seq
MIRT2360297	hsa-miR-4429	CLIP-seq
MIRT1464585	hsa-miR-4439	CLIP-seq
MIRT1464587	hsa-miR-4496	CLIP-seq
MIRT1464588	hsa-miR-4509	CLIP-seq
MIRT2360298	hsa-miR-4511	CLIP-seq
MIRT1464589	hsa-miR-4513	CLIP-seq
MIRT2360299	hsa-miR-4643	CLIP-seq
MIRT2360300	hsa-miR-4668-3p	CLIP-seq
MIRT2360301	hsa-miR-4678	CLIP-seq
MIRT2360302	hsa-miR-4684-5p	CLIP-seq
MIRT2360303	hsa-miR-4694-3p	CLIP-seq
MIRT1464591	hsa-miR-4722-5p	CLIP-seq
MIRT1464592	hsa-miR-4744	CLIP-seq
MIRT1464594	hsa-miR-4768-3p	CLIP-seq
MIRT2360304	hsa-miR-4768-5p	CLIP-seq
MIRT2360305	hsa-miR-4773	CLIP-seq
MIRT1464596	hsa-miR-483-3p	CLIP-seq
MIRT2139749	hsa-miR-498	CLIP-seq
MIRT1464597	hsa-miR-499-3p	CLIP-seq
MIRT1464598	hsa-miR-499a-3p	CLIP-seq
MIRT2360306	hsa-miR-505	CLIP-seq
MIRT1464600	hsa-miR-509-3-5p	CLIP-seq
MIRT1464601	hsa-miR-509-5p	CLIP-seq
MIRT1464602	hsa-miR-520a-5p	CLIP-seq
MIRT1464603	hsa-miR-525-5p	CLIP-seq
MIRT2360307	hsa-miR-548b-3p	CLIP-seq
MIRT1464611	hsa-miR-561	CLIP-seq
MIRT2360308	hsa-miR-583	CLIP-seq
MIRT1464612	hsa-miR-761	CLIP-seq
MIRT1464613	hsa-miR-922	CLIP-seq
MIRT2434388	hsa-miR-10a	CLIP-seq
MIRT2434389	hsa-miR-10b	CLIP-seq
MIRT2434390	hsa-miR-1206	CLIP-seq
MIRT2139735	hsa-miR-3133	CLIP-seq
MIRT2434391	hsa-miR-3144-3p	CLIP-seq
MIRT2434392	hsa-miR-339-5p	CLIP-seq
MIRT2434393	hsa-miR-3620	CLIP-seq
MIRT2434394	hsa-miR-3657	CLIP-seq
MIRT2434395	hsa-miR-369-3p	CLIP-seq
MIRT2434396	hsa-miR-374c	CLIP-seq
MIRT2434397	hsa-miR-3942-3p	CLIP-seq
MIRT2139746	hsa-miR-4528	CLIP-seq
MIRT2434398	hsa-miR-4669	CLIP-seq
MIRT2434399	hsa-miR-4698	CLIP-seq
MIRT2434400	hsa-miR-4795-3p	CLIP-seq
MIRT2434401	hsa-miR-5096	CLIP-seq
MIRT2434402	hsa-miR-606	CLIP-seq
MIRT2434403	hsa-miR-655	CLIP-seq
MIRT2434404	hsa-miR-875-5p	CLIP-seq
MIRT2434391	hsa-miR-3144-3p	CLIP-seq
MIRT2434400	hsa-miR-4795-3p	CLIP-seq
MIRT2434404	hsa-miR-875-5p	CLIP-seq
MIRT2653664	hsa-miR-1	CLIP-seq
MIRT1464553	hsa-miR-103a	CLIP-seq
MIRT1464554	hsa-miR-107	CLIP-seq
MIRT1464555	hsa-miR-1184	CLIP-seq
MIRT1464558	hsa-miR-139-5p	CLIP-seq
MIRT2653665	hsa-miR-141	CLIP-seq
MIRT2653666	hsa-miR-200a	CLIP-seq
MIRT2653667	hsa-miR-206	CLIP-seq
MIRT1464559	hsa-miR-214	CLIP-seq
MIRT1464560	hsa-miR-219-1-3p	CLIP-seq
MIRT1464567	hsa-miR-3120-5p	CLIP-seq
MIRT2653668	hsa-miR-3125	CLIP-seq
MIRT2653669	hsa-miR-3146	CLIP-seq
MIRT2653670	hsa-miR-3154	CLIP-seq
MIRT1464570	hsa-miR-3158-5p	CLIP-seq
MIRT1464571	hsa-miR-3160-5p	CLIP-seq
MIRT2139738	hsa-miR-3179	CLIP-seq
MIRT1464573	hsa-miR-3180-5p	CLIP-seq
MIRT1464574	hsa-miR-3185	CLIP-seq
MIRT2653671	hsa-miR-330-3p	CLIP-seq
MIRT1464577	hsa-miR-3545-3p	CLIP-seq
MIRT1464578	hsa-miR-3619-5p	CLIP-seq
MIRT2653672	hsa-miR-3673	CLIP-seq
MIRT2653673	hsa-miR-3916	CLIP-seq
MIRT2653674	hsa-miR-4300	CLIP-seq
MIRT2139742	hsa-miR-4307	CLIP-seq
MIRT1464583	hsa-miR-4418	CLIP-seq
MIRT1464586	hsa-miR-4494	CLIP-seq
MIRT1464588	hsa-miR-4509	CLIP-seq
MIRT2653675	hsa-miR-4633-3p	CLIP-seq
MIRT1464590	hsa-miR-4652-3p	CLIP-seq
MIRT1464591	hsa-miR-4722-5p	CLIP-seq
MIRT1464592	hsa-miR-4744	CLIP-seq
MIRT1464594	hsa-miR-4768-3p	CLIP-seq
MIRT1464599	hsa-miR-499a-5p	CLIP-seq
MIRT1464600	hsa-miR-509-3-5p	CLIP-seq
MIRT1464601	hsa-miR-509-5p	CLIP-seq
MIRT1464602	hsa-miR-520a-5p	CLIP-seq
MIRT1464603	hsa-miR-525-5p	CLIP-seq
MIRT2653676	hsa-miR-548aa	CLIP-seq
MIRT1464604	hsa-miR-548ac	CLIP-seq
MIRT1464605	hsa-miR-548ae	CLIP-seq
MIRT1464606	hsa-miR-548aj	CLIP-seq
MIRT1464607	hsa-miR-548am	CLIP-seq
MIRT1464608	hsa-miR-548d-3p	CLIP-seq
MIRT2653677	hsa-miR-548p	CLIP-seq
MIRT1464609	hsa-miR-548x	CLIP-seq
MIRT1464610	hsa-miR-548z	CLIP-seq
MIRT1464611	hsa-miR-561	CLIP-seq
MIRT2653678	hsa-miR-607	CLIP-seq
MIRT2653679	hsa-miR-610	CLIP-seq
MIRT2653680	hsa-miR-613	CLIP-seq
MIRT1464612	hsa-miR-761	CLIP-seq
MIRT2653681	hsa-miR-877	CLIP-seq
MIRT2653682	hsa-miR-920	CLIP-seq
MIRT1464613	hsa-miR-922	CLIP-seq
MIRT2653683	hsa-miR-939	CLIP-seq
MIRT2653664	hsa-miR-1	CLIP-seq
MIRT1464553	hsa-miR-103a	CLIP-seq
MIRT1464554	hsa-miR-107	CLIP-seq
MIRT1464555	hsa-miR-1184	CLIP-seq
MIRT1464558	hsa-miR-139-5p	CLIP-seq
MIRT2653665	hsa-miR-141	CLIP-seq
MIRT2653666	hsa-miR-200a	CLIP-seq
MIRT2653667	hsa-miR-206	CLIP-seq
MIRT1464559	hsa-miR-214	CLIP-seq
MIRT1464560	hsa-miR-219-1-3p	CLIP-seq
MIRT1464567	hsa-miR-3120-5p	CLIP-seq
MIRT2653668	hsa-miR-3125	CLIP-seq
MIRT2653669	hsa-miR-3146	CLIP-seq
MIRT2653670	hsa-miR-3154	CLIP-seq
MIRT1464570	hsa-miR-3158-5p	CLIP-seq
MIRT1464571	hsa-miR-3160-5p	CLIP-seq
MIRT2139738	hsa-miR-3179	CLIP-seq
MIRT1464573	hsa-miR-3180-5p	CLIP-seq
MIRT1464574	hsa-miR-3185	CLIP-seq
MIRT2653671	hsa-miR-330-3p	CLIP-seq
MIRT1464577	hsa-miR-3545-3p	CLIP-seq
MIRT1464578	hsa-miR-3619-5p	CLIP-seq
MIRT2653672	hsa-miR-3673	CLIP-seq
MIRT2653673	hsa-miR-3916	CLIP-seq
MIRT2653674	hsa-miR-4300	CLIP-seq
MIRT2139742	hsa-miR-4307	CLIP-seq
MIRT2694521	hsa-miR-4330	CLIP-seq
MIRT1464583	hsa-miR-4418	CLIP-seq
MIRT1464586	hsa-miR-4494	CLIP-seq
MIRT1464588	hsa-miR-4509	CLIP-seq
MIRT2653675	hsa-miR-4633-3p	CLIP-seq
MIRT1464590	hsa-miR-4652-3p	CLIP-seq
MIRT1464591	hsa-miR-4722-5p	CLIP-seq
MIRT1464592	hsa-miR-4744	CLIP-seq
MIRT1464594	hsa-miR-4768-3p	CLIP-seq
MIRT2139749	hsa-miR-498	CLIP-seq
MIRT1464599	hsa-miR-499a-5p	CLIP-seq
MIRT1464600	hsa-miR-509-3-5p	CLIP-seq
MIRT1464601	hsa-miR-509-5p	CLIP-seq
MIRT1464602	hsa-miR-520a-5p	CLIP-seq
MIRT1464603	hsa-miR-525-5p	CLIP-seq
MIRT2653676	hsa-miR-548aa	CLIP-seq
MIRT1464604	hsa-miR-548ac	CLIP-seq
MIRT1464605	hsa-miR-548ae	CLIP-seq
MIRT1464606	hsa-miR-548aj	CLIP-seq
MIRT1464607	hsa-miR-548am	CLIP-seq
MIRT1464608	hsa-miR-548d-3p	CLIP-seq
MIRT2653677	hsa-miR-548p	CLIP-seq
MIRT1464609	hsa-miR-548x	CLIP-seq
MIRT1464610	hsa-miR-548z	CLIP-seq
MIRT1464611	hsa-miR-561	CLIP-seq
MIRT2653678	hsa-miR-607	CLIP-seq
MIRT2653679	hsa-miR-610	CLIP-seq
MIRT2653680	hsa-miR-613	CLIP-seq
MIRT1464612	hsa-miR-761	CLIP-seq
MIRT2653681	hsa-miR-877	CLIP-seq
MIRT2653682	hsa-miR-920	CLIP-seq
MIRT1464613	hsa-miR-922	CLIP-seq
MIRT2653683	hsa-miR-939	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001818	Process	Negative regulation of cytokine production	IDA	17164348
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0009888	Process	Tissue development	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030510	Process	Regulation of BMP signaling pathway	IBA
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IDA	17164348
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0043010	Process	Camera-type eye development	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0050431	Function	Transforming growth factor beta binding	IDA	17164348
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	17164348
GO:2000515	Process	Negative regulation of CD4-positive, alpha-beta T cell activation	IDA	17164348
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	17164348

MIM	HGNC	e!Ensembl
605049	12429	ENSG00000128791

Q9GZX9

Protein name

Twisted gastrulation protein homolog 1

Protein function

May be involved in dorsoventral axis formation. Seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors. In addition to the anti-BMP function, also has pro-BMP ac

PDB

8BWA , 8BWD , 8BWI , 8BWL , 8BWM , 8BWN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04668	Tsg	86 → 222	Twisted gastrulation (Tsg) protein conserved region	Family

Sequence

MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECM
LCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVS
FPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQ
CKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Sequence length

223

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HOLOPROSENCEPHALY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alobar Holoprosencephaly	Alobar Holoprosencephaly	CTD_human_DG	15013800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arhinencephaly	Arrhinencephaly	CTD_human_DG	15013800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17164348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14499696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11414476, 15354217, 18483325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21283676, 34329471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	15036368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20193080, 20626849, 25119593, 31013839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23055343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12937151, 37120619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12362274, 12771950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26943038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33717076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12771950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14499696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12937151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27744626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23885148, 24146633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	GENOMICS_ENGLAND_DG	11260717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	22820187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34360647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	17164348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	CTD_human_DG	15013800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Holoprosencephaly	Holoprosencephaly	BEFREE	20493240, 21227728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Jaw Abnormalities	Jaw Abnormalities	CTD_human_DG	15013800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	11414476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12937151, 22407776, 29234432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12937151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lobar Holoprosencephaly	Lobar Holoprosencephaly	CTD_human_DG	15013800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24096489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11414476, 15354217, 18483325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12362274, 12771950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	15036368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29756996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12124802, 22879877, 23055343, 23445528, 24018353, 26099335, 30945018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22879877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14688019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	16319530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15036368, 15382043, 18751390, 23144779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23144779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11414476, 12362274, 12771950, 15867337, 18751390, 18836487, 19340654, 22984959, 23670097, 24023736, 25585126, 27225590, 28928871, 29468541, 29756996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22984959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10213214, 20193080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34944094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	27715452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28928871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30002361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34294873, 38429210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Semilobar Holoprosencephaly	Semilobar Holoprosencephaly	CTD_human_DG	15013800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	16432833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17620329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33594807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29756996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18985039, 20626849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34944094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	30122583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24577895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23522960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TWSG1 (twisted gastrulation BMP signaling modulator 1)