Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57016
Gene name	Aldo-keto reductase family 1 member B10
Gene symbol	AKR1B10
Synonyms (NCBI Gene)	AKR1B11AKR1B12ALDRLnARL-1ARL1HISHSI
Chromosome	7
Chromosome location	7q33
Summary	This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in

113

Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021442	hsa-miR-9-5p	Microarray	17612493
MIRT021503	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT027833	hsa-miR-98-5p	Microarray	19088304
MIRT510048	hsa-miR-3123	PAR-CLIP	20371350
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT510045	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT510044	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT510043	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT510042	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT510039	hsa-miR-3919	PAR-CLIP	20371350
MIRT510038	hsa-miR-922	PAR-CLIP	20371350
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT510048	hsa-miR-3123	PAR-CLIP	20371350
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT510045	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT510044	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT510043	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT510042	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564349	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT510039	hsa-miR-3919	PAR-CLIP	20371350
MIRT510038	hsa-miR-922	PAR-CLIP	20371350
MIRT564348	hsa-miR-7515	PAR-CLIP	20371350
MIRT564347	hsa-miR-3179	PAR-CLIP	20371350
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT564346	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT510048	hsa-miR-3123	PAR-CLIP	23446348
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT510045	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT510044	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT510043	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT510042	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT510039	hsa-miR-3919	PAR-CLIP	23446348
MIRT510038	hsa-miR-922	PAR-CLIP	23446348
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT498198	hsa-miR-142-3p	PAR-CLIP	22291592
MIRT498197	hsa-miR-452-5p	PAR-CLIP	22291592
MIRT498196	hsa-miR-4676-3p	PAR-CLIP	22291592
MIRT498195	hsa-miR-892c-3p	PAR-CLIP	22291592
MIRT498194	hsa-miR-1244	PAR-CLIP	22291592
MIRT498193	hsa-miR-648	PAR-CLIP	22291592
MIRT498192	hsa-miR-628-3p	PAR-CLIP	22291592
MIRT498191	hsa-miR-325	PAR-CLIP	22291592
MIRT498190	hsa-miR-548ao-5p	PAR-CLIP	22291592
MIRT498189	hsa-miR-548ax	PAR-CLIP	22291592
MIRT498188	hsa-miR-5585-5p	PAR-CLIP	22291592
MIRT498187	hsa-miR-3136-5p	PAR-CLIP	22291592
MIRT498186	hsa-miR-4439	PAR-CLIP	22291592
MIRT498185	hsa-miR-943	PAR-CLIP	22291592
MIRT498184	hsa-miR-3611	PAR-CLIP	22291592
MIRT510048	hsa-miR-3123	PAR-CLIP	20371350
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT510045	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT510044	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT510043	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT510042	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT510039	hsa-miR-3919	PAR-CLIP	20371350
MIRT510038	hsa-miR-922	PAR-CLIP	20371350
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT510048	hsa-miR-3123	PAR-CLIP	20371350
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT510045	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT510044	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT510043	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT510042	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT564349	hsa-miR-3940-3p	PAR-CLIP	20371350
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	20371350
MIRT510039	hsa-miR-3919	PAR-CLIP	20371350
MIRT510038	hsa-miR-922	PAR-CLIP	20371350
MIRT564348	hsa-miR-7515	PAR-CLIP	20371350
MIRT564347	hsa-miR-3179	PAR-CLIP	20371350
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT564346	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT510048	hsa-miR-3123	PAR-CLIP	23446348
MIRT510047	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT510046	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT510045	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT510044	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT510043	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT510042	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT510040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT510041	hsa-miR-6760-5p	PAR-CLIP	23446348
MIRT510039	hsa-miR-3919	PAR-CLIP	23446348
MIRT510038	hsa-miR-922	PAR-CLIP	23446348
MIRT510037	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT498198	hsa-miR-142-3p	PAR-CLIP	22291592
MIRT498197	hsa-miR-452-5p	PAR-CLIP	22291592
MIRT498196	hsa-miR-4676-3p	PAR-CLIP	22291592
MIRT498195	hsa-miR-892c-3p	PAR-CLIP	22291592
MIRT498194	hsa-miR-1244	PAR-CLIP	22291592
MIRT498193	hsa-miR-648	PAR-CLIP	22291592
MIRT498192	hsa-miR-628-3p	PAR-CLIP	22291592
MIRT498191	hsa-miR-325	PAR-CLIP	22291592
MIRT498190	hsa-miR-548ao-5p	PAR-CLIP	22291592
MIRT498189	hsa-miR-548ax	PAR-CLIP	22291592
MIRT498188	hsa-miR-5585-5p	PAR-CLIP	22291592
MIRT498187	hsa-miR-3136-5p	PAR-CLIP	22291592
MIRT498186	hsa-miR-4439	PAR-CLIP	22291592
MIRT498185	hsa-miR-943	PAR-CLIP	22291592
MIRT498184	hsa-miR-3611	PAR-CLIP	22291592

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IDA	12732097
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001758	Function	Retinal dehydrogenase (NAD+) activity	IDA	21851338
GO:0004032	Function	Aldose reductase (NADPH) activity	IBA
GO:0005515	Function	Protein binding	IPI	18056116, 21044950, 33961781
GO:0005576	Component	Extracellular region	IDA	21585341
GO:0005576	Component	Extracellular region	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005764	Component	Lysosome	IDA	21585341
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IDA	19013440
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	TAS	9565553
GO:0016488	Process	Farnesol catabolic process	IDA	21187079
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0042572	Process	Retinol metabolic process	IEA
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0045550	Function	Geranylgeranyl reductase activity	IDA	21187079
GO:0047655	Function	Allyl-alcohol dehydrogenase activity	IEA
GO:0047718	Function	Indanol dehydrogenase activity	IDA	20837989
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IDA	12732097
GO:0052650	Function	All-trans-retinol dehydrogenase (NADP+) activity	IEA
GO:0110095	Process	Cellular detoxification of aldehyde	IDA	19013440, 19563777

MIM	HGNC	e!Ensembl
604707	382	ENSG00000198074

O60218

Protein name

Aldo-keto reductase family 1 member B10 (EC 1.1.1.300) (EC 1.1.1.54) (ARL-1) (Aldose reductase-like) (Aldose reductase-related protein) (ARP) (hARP) (Small intestine reductase) (SI reductase)

Protein function

Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols (PubMed:12732097, PubMed:18087047, PubMed:19013440, PubMed:19563777, PubMed:9565553). Displays strong enzymatic activity t

PDB

1ZUA , 4GA8 , 4GAB , 4GQ0 , 4GQG , 4I5X , 4ICC , 4JIH , 4JII , 4WEV , 4XZL , 4XZM , 4XZN , 5LIK , 5LIU , 5LIW , 5LIX , 5LIY , 5M2F , 5Y7N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	15 → 294	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland. {ECO:0000269|PubMed:9565553}.

Sequence

MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY

Sequence length

316

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Fructose and mannose metabolism Galactose metabolism Glycerolipid metabolism Folate biosynthesis Metabolic pathways		Retinoid metabolism and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (130)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28440306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15755999, 19442055, 22222635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18396902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	18396902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17597105, 19236911, 30253058, 30692511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22222635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24140838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34027794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23689354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16127462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	18396902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	18396902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	17329238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	26835713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9973098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder exstrophy	Pubtator	37509153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22198799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31034948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28402270, 29846015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10864204, 18056116, 19028477, 24217247, 35807227, 37389562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22014576, 28402270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30320113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18788756, 24656094, 28402270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18325492, 22222635, 26835713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18056116, 18325492, 19028477, 19236911, 23071592, 24391771, 24747592, 25287169, 26516929, 26948042, 27387388, 27672277, 28181486, 30038373, 30125264, 32968147, 33574818, 35178834, 9565553 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22681639, 24656094, 30328412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22198799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20705797, 22222635, 22329800, 24813866, 25463304, 29207124, 30253058, 31034948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17425679, 19236911, 37442189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21672310, 26835713	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19442055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28600294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19442055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20036025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	25538260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31495535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24140838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17597105, 24140838, 24599561, 25538260, 28929377, 31413744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17597105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17597105		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19567817		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24599561	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36301939	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16763151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28219640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28929377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28929377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23975544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	15745835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19442055, 23146748, 28232277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23146748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17425679	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23146748		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	21829465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23071592	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	24747592, 37037945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30379862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30379862, 30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21109939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21109939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallervorden-Spatz Syndrome	Pigmentary pallidal degeneration	BEFREE	12058097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22681639, 27672277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	26835713	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoprebetalipoproteinemia, Acanthocytosis, Retinitis Pigmentosa, And Pallidal Degeneration	Hypoprebetalipoproteinemia, Acanthocytosis, Retinitis Pigmentosa, And Pallidal Degeneration	BEFREE	12058097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29846015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	20398667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	30320113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10451122, 17597105, 18056116, 19236911, 20036025, 22329800, 22681639, 24972180, 25487531, 26516929, 26758591, 27084455, 28181486, 29079172, 29383608 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30328412, 31495535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	30328412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10451122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17209433, 18358633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19643728, 30253058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31034948, 32097409, 37587486	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26948042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28402270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23912490, 27855345, 28402270, 29846015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19442055, 23146748, 28232277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	27417252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18325492, 31034948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20705797, 22222635, 22329800, 24813866, 25463304, 29207124, 30253058, 31034948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17072959, 22222635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	9973098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24406159, 30655829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22198799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	17329238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17597105, 21829465, 24813866, 24884630, 26758591, 27084455, 28161411, 28929377, 29079172, 29383608, 29532688, 30038373, 30469331, 31028727, 31598161, 31749429 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19442055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24140838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18056116		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	21499247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26835713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26835713, 33767586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	BEFREE	26835713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	17329238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19442055, 20036025, 21109939, 21672310, 22329800, 24140838, 24406159, 24451080, 25304374, 26516929, 26835713, 27855345, 28181486, 28232277, 28402270 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15755999, 18056116, 19442055, 20705797, 21672310, 28219640, 28976752, 31034948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37884970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17072959, 22222635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23689354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	29079172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28440306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma type 2	Papillary Renal Carcinoma	BEFREE	22014576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	9973098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31682594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29204449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30078618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schimke immunoosseous dysplasia	Spondyloepiphyseal dysplasia nephrotic syndrome	BEFREE	21327070, 28334870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15755999, 19442055, 28301069, 30430672, 31237374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17425679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23071592, 25182422, 30379862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24406159, 30655829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20398667, 35974335, 36661656, 37039038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34552036	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38600165, 40613296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	16439455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25538260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	26835713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17425679, 19028477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	17425679, 19028477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30707282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33463119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AKR1B10 (aldo-keto reductase family 1 member B10)