Gene Gene information from NCBI Gene database.
Entrez ID 57010
Gene name Calcium binding protein 4
Gene symbol CABP4
Synonyms (NCBI Gene)
CRSDCSNB2B
Chromosome 11
Chromosome location 11q13.2
Summary This gene encodes a member of the CABP family of calcium binding protein characterized by four EF-hand motifs. Mutations in this gene are associated with congenital stationary night blindness type 2B. Three transcript variants encoding two different isofo
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs121917828 C>T Pathogenic Coding sequence variant, missense variant
rs150115958 C>A,T Likely-pathogenic, pathogenic Stop gained, genic downstream transcript variant, synonymous variant, coding sequence variant, downstream transcript variant
rs531851447 C>T Likely-pathogenic Genic downstream transcript variant, coding sequence variant, stop gained
rs754194692 C>A,G,T Conflicting-interpretations-of-pathogenicity Intron variant, synonymous variant, coding sequence variant, missense variant
rs761991624 C>A,T Pathogenic Synonymous variant, stop gained, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
632
miRTarBase ID miRNA Experiments Reference
MIRT708997 hsa-miR-1913 HITS-CLIP 19536157
MIRT708996 hsa-miR-324-3p HITS-CLIP 19536157
MIRT708995 hsa-miR-18a-3p HITS-CLIP 19536157
MIRT708994 hsa-miR-6749-3p HITS-CLIP 19536157
MIRT708993 hsa-miR-4727-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005246 Function Calcium channel regulator activity IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding NAS 16960802
GO:0005509 Function Calcium ion binding TAS 15452577
GO:0005576 Component Extracellular region NAS 16960802
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608965 1386 ENSG00000175544
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57796
Protein name Calcium-binding protein 4 (CaBP4)
Protein function Involved in normal synaptic function through regulation of Ca(2+) influx and neurotransmitter release in photoreceptor synaptic terminals and in auditory transmission. Modulator of CACNA1D and CACNA1F, suppressing the calcium-dependent inactivat
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 133 161 EF hand Domain
PF13499 EF-hand_7 209 273 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in retina and in the inner hair cells (IHC) of the cochlea.
Sequence
MTTEQARGQQGPNLAIGRQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGE
QTGPEAPGSSNNPPSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVF
GKDRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMR
MGGRVDFEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLG
EPLAGPELDEMLREVDLNGDGTVDFDEFVMMLS
RH
Sequence length 275
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Achromatopsia Pathogenic rs150115958 RCV000787800
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone dystrophy Pathogenic rs531851447 RCV000504725
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-rod dystrophy Pathogenic rs150115958 RCV000787550
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-rod synaptic disorder, congenital nonprogressive Pathogenic; Likely pathogenic rs745382789, rs777555935, rs779788706, rs786205249, rs150115958, rs786205852, rs199636248, rs531851447, rs1590998813, rs775166854 RCV001542588
RCV001542589
RCV003387538
RCV000002029
RCV000171132
View all (5 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Aland island eye disease Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT NOCTURNAL FRONTAL LOBE EPILEPSY Disgenet
Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CABP4-related disorder Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONE-ROD DYSTROPHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Achromatopsia Achromatopsia CLINVAR_DG 30718709
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Amaurosis congenita of Leber type 1 Leber congenital amaurosis Pubtator 40294858 Associate
★☆☆☆☆
Found in Text Mining only
Amaurosis congenita of Leber, type 1 Leber congenital amaurosis BEFREE 20157620
★☆☆☆☆
Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy Nocturnal Epilepsy ORPHANET_DG 29108277
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal dominant nocturnal frontal lobe epilepsy Nocturnal Epilepsy Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cone Dystrophy Cone Dystrophy CLINVAR_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-Rod Dystrophies Cone-rod dystrophy CLINVAR_DG 30718709
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cone-rod synaptic disorder, congenital nonprogressive Congenital stationary night blindness UNIPROT_DG 16960802
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cone-rod synaptic disorder, congenital nonprogressive Congenital stationary night blindness CTD_human_DG
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cone-rod synaptic disorder, congenital nonprogressive Congenital stationary night blindness GENOMICS_ENGLAND_DG
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)