Gene Gene information from NCBI Gene database.
Entrez ID 56997
Gene name Coenzyme Q8A
Gene symbol COQ8A
Synonyms (NCBI Gene)
ADCK3ARCA2CABC1COQ10D4COQ8SCAR9
Chromosome 1
Chromosome location 1q42.13
Summary This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced
SNPs SNP information provided by dbSNP.
54
SNP ID Visualize variation Clinical significance Consequence
rs74589348 C>G,T Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, synonymous variant
rs119468004 G>A,C Pathogenic Missense variant, coding sequence variant
rs119468005 C>G,T Likely-pathogenic, pathogenic Missense variant, coding sequence variant
rs119468006 G>A,T Pathogenic Missense variant, coding sequence variant
rs119468008 A>G Pathogenic Missense variant, coding sequence variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IDA 27499294
GO:0004672 Function Protein kinase activity ISS
GO:0005515 Function Protein binding IPI 16189514, 25416956, 25910212, 27499296, 31515488, 32296183, 32814053
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606980 16812 ENSG00000163050
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NI60
Protein name Atypical kinase COQ8A, mitochondrial (EC 2.7.-.-) (Chaperone activity of bc1 complex-like) (Chaperone-ABC1-like) (Coenzyme Q protein 8A) (aarF domain-containing protein kinase 3)
Protein function Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PubMed:21296186, PubMed:25498144, PubMed:25540914, PubMed:27499294, PubMed:36302
PDB 4PED , 5I35 , 7UDP , 7UDQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03109 ABC1 318 434 ABC1 family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in adrenal gland, heart, pancreas, nasal mucosa, stomach, uterus and skeletal muscle. {ECO:0000269|PubMed:24270420}.
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIV
DELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAK
SIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
Sequence length 647
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
35
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive ataxia due to ubiquinone deficiency Pathogenic; Likely pathogenic rs754586499, rs1229054489, rs1433323183, rs1474965033, rs1553281318, rs119468005, rs119468006, rs387906298, rs606231138, rs606231139, rs119468008, rs387906299, rs797045217, rs578189699, rs764847439
View all (32 more)
RCV001647227
RCV001647226
RCV001647228
RCV002272750
RCV000985120
View all (44 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cerebellar ataxia Likely pathogenic rs959109094 RCV001541908
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Coenzyme Q10 deficiency, primary, 1 Likely pathogenic rs1558212305, rs1658479678 RCV000721972
RCV001195421
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COQ8A-related disorder Likely pathogenic; Pathogenic rs1194024312, rs1473126291 RCV003404295
RCV003414461
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormality of the nervous system Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal recessive cerebellar ataxia Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
CATARACT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anxiety Anxiety Disorder GWASCAT_DG 29942085
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 21873089, 24164873, 26866375, 29915382, 32337771 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Like Disorder Ataxia telangiectasia Pubtator 29915382 Associate
★☆☆☆☆
Found in Text Mining only
Ataxia with vitamin E deficiency Friedreich Ataxia BEFREE 19440741
★☆☆☆☆
Found in Text Mining only
Ataxia, Spinocerebellar Spinocerebellar Ataxia BEFREE 30968303, 31078656
★☆☆☆☆
Found in Text Mining only
Autosomal recessive ataxia due to ubiquinone deficiency Ataxia Orphanet
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Cerebellar Ataxia Cerebellar ataxia Pubtator 18319072, 24218524, 25216398, 26818466, 32743982, 34663476 Associate
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebellar atrophy Cerebellar atrophy HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cerebellar atrophy Cerebellar atrophy CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cerebellar Diseases Cerebellar diseases Pubtator 18319072, 24164873, 35275351 Associate
★☆☆☆☆
Found in Text Mining only