Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56971
Gene name	CEA cell adhesion molecule 19
Gene symbol	CEACAM19
Synonyms (NCBI Gene)	CEACM19CEAL1
Chromosome	19
Chromosome location	19q13.31

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments
MIRT882943	hsa-miR-1253	CLIP-seq
MIRT882944	hsa-miR-153	CLIP-seq
MIRT882945	hsa-miR-2110	CLIP-seq
MIRT882946	hsa-miR-2355-3p	CLIP-seq
MIRT882947	hsa-miR-2861	CLIP-seq
MIRT882948	hsa-miR-3150a-3p	CLIP-seq
MIRT882949	hsa-miR-3175	CLIP-seq
MIRT882950	hsa-miR-3179	CLIP-seq
MIRT882951	hsa-miR-3202	CLIP-seq
MIRT882952	hsa-miR-342-5p	CLIP-seq
MIRT882953	hsa-miR-3921	CLIP-seq
MIRT882954	hsa-miR-3936	CLIP-seq
MIRT882955	hsa-miR-4260	CLIP-seq
MIRT882956	hsa-miR-4271	CLIP-seq
MIRT882957	hsa-miR-4312	CLIP-seq
MIRT882958	hsa-miR-4432	CLIP-seq
MIRT882959	hsa-miR-4434	CLIP-seq
MIRT882960	hsa-miR-4516	CLIP-seq
MIRT882961	hsa-miR-4522	CLIP-seq
MIRT882962	hsa-miR-4531	CLIP-seq
MIRT882963	hsa-miR-4649-3p	CLIP-seq
MIRT882964	hsa-miR-4651	CLIP-seq
MIRT882965	hsa-miR-4653-5p	CLIP-seq
MIRT882966	hsa-miR-4664-5p	CLIP-seq
MIRT882967	hsa-miR-4714-5p	CLIP-seq
MIRT882968	hsa-miR-4725-3p	CLIP-seq
MIRT882969	hsa-miR-4731-5p	CLIP-seq
MIRT882970	hsa-miR-4747-5p	CLIP-seq
MIRT882971	hsa-miR-4763-5p	CLIP-seq
MIRT882972	hsa-miR-608	CLIP-seq
MIRT882973	hsa-miR-676	CLIP-seq
MIRT882974	hsa-miR-2467-5p	CLIP-seq
MIRT882947	hsa-miR-2861	CLIP-seq
MIRT882950	hsa-miR-3179	CLIP-seq
MIRT882951	hsa-miR-3202	CLIP-seq
MIRT882954	hsa-miR-3936	CLIP-seq
MIRT882975	hsa-miR-4446-3p	CLIP-seq
MIRT882976	hsa-miR-4492	CLIP-seq
MIRT882977	hsa-miR-4498	CLIP-seq
MIRT882978	hsa-miR-4505	CLIP-seq
MIRT882979	hsa-miR-4721	CLIP-seq
MIRT882969	hsa-miR-4731-5p	CLIP-seq
MIRT882970	hsa-miR-4747-5p	CLIP-seq
MIRT882971	hsa-miR-4763-5p	CLIP-seq
MIRT882980	hsa-miR-4779	CLIP-seq
MIRT882981	hsa-miR-762	CLIP-seq
MIRT882947	hsa-miR-2861	CLIP-seq
MIRT882950	hsa-miR-3179	CLIP-seq
MIRT882951	hsa-miR-3202	CLIP-seq
MIRT882954	hsa-miR-3936	CLIP-seq
MIRT882970	hsa-miR-4747-5p	CLIP-seq
MIRT882971	hsa-miR-4763-5p	CLIP-seq
MIRT882950	hsa-miR-3179	CLIP-seq
MIRT882954	hsa-miR-3936	CLIP-seq

Show/Hide all (2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20374249
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
606691	31951	ENSG00000186567

Q7Z692

Protein name

Cell adhesion molecule CEACAM19 (Carcinoembryonic antigen-like 1) (Carcinoembryonic antigen-related cell adhesion molecule 19) (CEA cell adhesion molecule 19)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	22 → 141	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with highest expression in prostate, uterus, fetal brain, mammary gland, adrenal gland, skeletal muscle, small intestine, and kidney, and lower expression in lung, cerebellum, testis, liver, pancreas, bone marrow and ovary.

Sequence

MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTF
QDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTY
QVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYL
LVTRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNI
YEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPAPYCQLVPTS

Sequence length

300

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	33947463	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21460841, 24755620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12801635, 23525470, 27909883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36010616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32659328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12801635, 23525470, 27909883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	30679925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30217308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23525470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32659328	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30217308		★★★★★ ★☆☆☆☆ Found in Text Mining only

CEACAM19 (CEA cell adhesion molecule 19)