PYY (peptide YY)

Gene

• Entrez ID: 5697
• Gene name: Peptide YY
• Gene symbol: PYY
• Synonyms (NCBI Gene): PYY-I, PYY1
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT2308047	hsa-miR-1827	CLIP-seq
MIRT2308048	hsa-miR-3612	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT2308049	hsa-miR-650	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	7493937, 7592911
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	10698177
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007631	Process	Feeding behavior	IBA
GO:0007631	Process	Feeding behavior	TAS	10698177
GO:0031841	Function	Neuropeptide Y receptor binding	IBA
GO:0060575	Process	Intestinal epithelial cell differentiation	TAS	10488139

Other IDs

• MIM: 600781
• HGNC: 9748
• e!Ensembl: ENSG00000131096

Protein

• UniProt ID: P10082
• Protein name: Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)]
• Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
• PDB: 2DEZ, 2DF0, 2L60, 2NA5, 7RT9, 7YON
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00159	Hormone_3	30 → 64	Pancreatic hormone peptide	Family

• Sequence:

  MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
  RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW

• Sequence length: 97

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERAMMONEMIA, TYPE III	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECT, FOLATE-SENSITIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS X-LINKED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Uncertain significance	ClinVar CTD, Disgenet CTD, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acrania	Acrania	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27918953, 29288273		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	11825654		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10363747		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29070909	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	10363747		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28027898		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	16950139, 28626523, 30023658, 31306808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	22903826, 29689362		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	LHGDN	16278259, 18486583		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	27811940, 30597915, 31306808		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30597915		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30597915		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34239365	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31292496		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	29219202, 30915029, 31306252		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10612539		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	3374119	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31541684		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32058945, 32462020, 32797167, 34796980	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24389497		★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19956723	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21410462, 8625912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	31590062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	27787482, 28533020, 28892258, 29311617, 29412828, 30399314, 30639417		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26734798	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27787482, 28533020, 28892258, 29311617, 29412828, 30399314, 30639417		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29311617	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15983231, 17045646, 18317469, 27405092, 27696668, 28533020, 29635505, 29688303, 30759215, 31692207, 31741078		★☆☆☆☆ Found in Text Mining only
Diastematomyelia	Diastematomyelia	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	29226618		★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30911572		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17045646, 25453978, 29037268, 29232262, 31035472		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	LHGDN	17045646		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18622237		★☆☆☆☆ Found in Text Mining only
Iniencephaly	Anencephaly	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28106168		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22057239	Inhibit	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	26162959, 28764761, 31727345		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	28764761	Associate	★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	16756746		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31292496		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25533827		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11825654		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10612539		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	11825654		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11825654		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	21410462, 8625912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	31590062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	19820027	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19820027		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	40142315	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25533827		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	CTD_human_DG	17400914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurenteric Cyst	Neurenteric Cyst	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15331560, 15754036, 15855352, 16331299, 16368708, 16756746, 16950139, 17045646, 17235527, 18317469, 18441153, 18622237, 19820027, 23990519, 24259562, 25453978, 27405092, 28626523, 29191090, 29311617, 29412828, 29688303, 29883788, 30399314, 30639417, 30678628, 31306808		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	Pubtator	15754036, 15855352, 19325538, 19820027, 20642810, 26381270, 29311617, 33300990	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	CTD_human_DG	16368708		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity Morbid	Obesity	Pubtator	15855352	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	15855352, 17235527		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31306808		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30863364		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25533827		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17235527		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28293234		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	15754036		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15704095		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29275180		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	34239365	Stimulate	★☆☆☆☆ Found in Text Mining only
Spinal Cord Myelodysplasia	Spinal Cord Myelodysplasia	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only
Tethered Cord Syndrome	Primary Tethered cord syndrome	CTD_human_DG	17400914		★☆☆☆☆ Found in Text Mining only