PARP6 (poly(ADP-ribose) polymerase family member 6)

Gene

• Entrez ID: 56965
• Gene name: Poly(ADP-ribose) polymerase family member 6
• Gene symbol: PARP6
• Synonyms (NCBI Gene): ARTD17, PARP-6-B1, PARP-6-C, pART17
• Chromosome: 15
• Chromosome location: 15q23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029594	hsa-miR-26b-5p	Microarray	19088304
MIRT039144	hsa-miR-769-5p	CLASH	23622248
MIRT2061758	hsa-miR-1343	CLIP-seq
MIRT2061759	hsa-miR-3134	CLIP-seq
MIRT2061760	hsa-miR-3616-3p	CLIP-seq
MIRT2061761	hsa-miR-4436b-3p	CLIP-seq
MIRT2061762	hsa-miR-4721	CLIP-seq
MIRT2290144	hsa-miR-1244	CLIP-seq
MIRT2290145	hsa-miR-3168	CLIP-seq
MIRT2290146	hsa-miR-4699-3p	CLIP-seq
MIRT2290147	hsa-miR-520d-5p	CLIP-seq
MIRT2290148	hsa-miR-524-5p	CLIP-seq
MIRT2455940	hsa-miR-3153	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0005635	Component	Nuclear envelope	IBA
GO:0016020	Component	Membrane	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019900	Function	Kinase binding	IBA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0070213	Process	Protein auto-ADP-ribosylation	IDA	25043379
GO:0071782	Component	Endoplasmic reticulum tubular network	IBA
GO:0140803	Function	NAD+-protein-cysteine ADP-ribosyltransferase activity	IDA	25043379
GO:0140803	Function	NAD+-protein-cysteine ADP-ribosyltransferase activity	IEA
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IDA	25043379
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA

Other IDs

• MIM: 619439
• HGNC: 26921
• e!Ensembl: ENSG00000137817

Protein

• UniProt ID: Q2NL67
• Protein name: Protein mono-ADP-ribosyltransferase PARP6 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 17) (ARTD17) (Poly [ADP-ribose] polymerase 6) (PARP-6)
• Protein function: Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00644	PARP	450 → 593	Poly(ADP-ribose) polymerase catalytic domain	Family

• Sequence:

  MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIRE
  YGTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSN
  KEGFGLGLQLKKILGMFTSQQWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPI
  PKSPSFPIIQDSMLKGKLGVPELRVGRLMNRSISCTMKNPKVEVFGYPPSPQAGLLCPQH
  VGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSM
  LKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPS
  VVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW
  IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
  HSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYN
  RMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYED
  GQVGDANINTQDPKIQKEIMRVIGTQVYTN

• Sequence length: 630

Pathways

Reactome:

Nicotinamide salvaging

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28260087		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22833209	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30297535		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22833209	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23042038, 26934315		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26934315	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	26991471	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	22833209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30297535		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23042038		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23042038, 26934315, 28260087		★☆☆☆☆ Found in Text Mining only