Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56963
Gene name	Repulsive guidance molecule BMP co-receptor a
Gene symbol	RGMA
Synonyms (NCBI Gene)	RGM
Chromosome	15
Chromosome location	15q26.1
Summary	This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein m

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019379	hsa-miR-148b-3p	Microarray	17612493
MIRT040467	hsa-miR-615-3p	CLASH	23622248
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT438278	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	24517116
MIRT496585	hsa-miR-193a-3p	PAR-CLIP	22291592
MIRT496584	hsa-miR-193b-3p	PAR-CLIP	22291592
MIRT496583	hsa-miR-892b	PAR-CLIP	22291592
MIRT496582	hsa-miR-3190-5p	PAR-CLIP	22291592
MIRT496581	hsa-miR-3926	PAR-CLIP	22291592
MIRT496580	hsa-miR-548s	PAR-CLIP	22291592
MIRT496585	hsa-miR-193a-3p	PAR-CLIP	22291592
MIRT496584	hsa-miR-193b-3p	PAR-CLIP	22291592
MIRT496583	hsa-miR-892b	PAR-CLIP	22291592
MIRT496582	hsa-miR-3190-5p	PAR-CLIP	22291592
MIRT496581	hsa-miR-3926	PAR-CLIP	22291592
MIRT496580	hsa-miR-548s	PAR-CLIP	22291592
MIRT1302954	hsa-miR-1224-3p	CLIP-seq
MIRT1302955	hsa-miR-1255a	CLIP-seq
MIRT1302956	hsa-miR-1255b	CLIP-seq
MIRT1302957	hsa-miR-125a-3p	CLIP-seq
MIRT1302958	hsa-miR-1260	CLIP-seq
MIRT1302959	hsa-miR-1260b	CLIP-seq
MIRT1302960	hsa-miR-1263	CLIP-seq
MIRT1302961	hsa-miR-1280	CLIP-seq
MIRT1302962	hsa-miR-1285	CLIP-seq
MIRT1302963	hsa-miR-296-5p	CLIP-seq
MIRT1302964	hsa-miR-3187-5p	CLIP-seq
MIRT1302965	hsa-miR-3199	CLIP-seq
MIRT1302966	hsa-miR-331-3p	CLIP-seq
MIRT1302967	hsa-miR-3667-5p	CLIP-seq
MIRT1302968	hsa-miR-378g	CLIP-seq
MIRT1302969	hsa-miR-4308	CLIP-seq
MIRT1302970	hsa-miR-4314	CLIP-seq
MIRT1302971	hsa-miR-4486	CLIP-seq
MIRT1302972	hsa-miR-4709-3p	CLIP-seq
MIRT1302973	hsa-miR-4722-3p	CLIP-seq
MIRT1302974	hsa-miR-4725-5p	CLIP-seq
MIRT1302975	hsa-miR-4755-3p	CLIP-seq
MIRT1302976	hsa-miR-504	CLIP-seq
MIRT1302977	hsa-miR-532-3p	CLIP-seq
MIRT1302978	hsa-miR-612	CLIP-seq
MIRT1302979	hsa-miR-3157-5p	CLIP-seq
MIRT1302980	hsa-miR-3184	CLIP-seq
MIRT1302981	hsa-miR-423-5p	CLIP-seq
MIRT1302982	hsa-miR-4293	CLIP-seq
MIRT1302983	hsa-miR-4447	CLIP-seq
MIRT1302984	hsa-miR-4472	CLIP-seq
MIRT1302985	hsa-miR-4651	CLIP-seq
MIRT1302986	hsa-miR-544b	CLIP-seq
MIRT1302987	hsa-miR-608	CLIP-seq
MIRT1302988	hsa-miR-181a	CLIP-seq
MIRT1302989	hsa-miR-181b	CLIP-seq
MIRT1302990	hsa-miR-181c	CLIP-seq
MIRT1302991	hsa-miR-181d	CLIP-seq
MIRT1302980	hsa-miR-3184	CLIP-seq
MIRT1302967	hsa-miR-3667-5p	CLIP-seq
MIRT1302992	hsa-miR-377	CLIP-seq
MIRT1302981	hsa-miR-423-5p	CLIP-seq
MIRT1302993	hsa-miR-4262	CLIP-seq
MIRT1302982	hsa-miR-4293	CLIP-seq
MIRT1302972	hsa-miR-4709-3p	CLIP-seq
MIRT1302973	hsa-miR-4722-3p	CLIP-seq
MIRT1302974	hsa-miR-4725-5p	CLIP-seq
MIRT1302975	hsa-miR-4755-3p	CLIP-seq
MIRT1302976	hsa-miR-504	CLIP-seq
MIRT1302986	hsa-miR-544b	CLIP-seq
MIRT1553084	hsa-miR-1207-5p	CLIP-seq
MIRT1553085	hsa-miR-3158-3p	CLIP-seq
MIRT1553086	hsa-miR-3620	CLIP-seq
MIRT1553087	hsa-miR-4446-3p	CLIP-seq
MIRT1553088	hsa-miR-4736	CLIP-seq
MIRT1553089	hsa-miR-4763-3p	CLIP-seq
MIRT2314792	hsa-miR-3117-5p	CLIP-seq
MIRT1302992	hsa-miR-377	CLIP-seq
MIRT2393677	hsa-miR-1973	CLIP-seq
MIRT2393678	hsa-miR-3154	CLIP-seq
MIRT2393679	hsa-miR-3179	CLIP-seq
MIRT2393680	hsa-miR-4728-5p	CLIP-seq
MIRT2393681	hsa-miR-550a	CLIP-seq
MIRT2393682	hsa-miR-615-5p	CLIP-seq
MIRT2458121	hsa-miR-124	CLIP-seq
MIRT2458122	hsa-miR-1972	CLIP-seq
MIRT2458123	hsa-miR-3937	CLIP-seq
MIRT2458124	hsa-miR-4733-3p	CLIP-seq
MIRT2458125	hsa-miR-506	CLIP-seq
MIRT2458121	hsa-miR-124	CLIP-seq
MIRT2458122	hsa-miR-1972	CLIP-seq
MIRT2458123	hsa-miR-3937	CLIP-seq
MIRT2458124	hsa-miR-4733-3p	CLIP-seq
MIRT2458125	hsa-miR-506	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001843	Process	Neural tube closure	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 22728873, 25938661, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030509	Process	BMP signaling pathway	IBA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030510	Process	Regulation of BMP signaling pathway	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22728873
GO:0048671	Process	Negative regulation of collateral sprouting	IEA
GO:0048681	Process	Negative regulation of axon regeneration	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0098552	Component	Side of membrane	IEA
GO:1990459	Function	Transferrin receptor binding	IPI	22728873

MIM	HGNC	e!Ensembl
607362	30308	ENSG00000182175

Q96B86

Protein name

Repulsive guidance molecule A (RGM domain family member A)

Protein function

Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formatio

PDB

4UHY , 6Z3G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06535	RGM_N	48 → 222	Repulsive guidance molecule (RGM) N-terminus	Family
PF06534	RGM_C	226 → 406	Repulsive guidance molecule (RGM) C-terminus	Family

Sequence

MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSA
TSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGP
TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQT
CKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELP
AAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV
VNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETA
VAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDL
PGRAAAGLPLAPRPLLGALVPLLALLPVFC

Sequence length

450

Interactions

View interactions

	KEGG
	TGF-beta signaling pathway Axon guidance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrophy	Atrophy	Pubtator	35255809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	35028889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	35028889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21617229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36523479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	30665395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	29137400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	35028889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23028342, 24871321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31200090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	16736036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28228494, 30665395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34946941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26843113, 30816469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	26843113, 30816469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17606441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35255809	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	35028889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile hemochromatosis	Hemochromatosis	BEFREE	28007423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23028342, 24871321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30798120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30665395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21617229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30798120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25535400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28007423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29478698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	BEFREE	24932903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21423182, 25801027, 28007423, 30333477		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29311561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24932903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	28842419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25535400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25535400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37902305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32819133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31649243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31649243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGMA (repulsive guidance molecule BMP co-receptor a)