EMSY (EMSY transcriptional repressor, BRCA2 interacting)

Gene

• Entrez ID: 56946
• Gene name: EMSY transcriptional repressor, BRCA2 interacting
• Gene symbol: EMSY
• Synonyms (NCBI Gene): C11orf30, GL002
• Chromosome: 11
• Chromosome location: 11q13.5

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT503082	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT503077	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT480524	hsa-miR-3609	PAR-CLIP	20371350
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT480518	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT480517	hsa-miR-657	PAR-CLIP	20371350
MIRT503082	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT503077	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT480524	hsa-miR-3609	PAR-CLIP	20371350
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT480518	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT480517	hsa-miR-657	PAR-CLIP	20371350
MIRT503082	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT503077	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT480524	hsa-miR-3609	PAR-CLIP	21572407
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT480518	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT480517	hsa-miR-657	PAR-CLIP	21572407
MIRT503082	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT503077	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT480524	hsa-miR-3609	PAR-CLIP	21572407
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT480518	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT480517	hsa-miR-657	PAR-CLIP	21572407
MIRT503082	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT503077	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT480524	hsa-miR-3609	PAR-CLIP	22012620
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT480518	hsa-miR-329-5p	PAR-CLIP	22012620
MIRT480517	hsa-miR-657	PAR-CLIP	22012620
MIRT503082	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT503081	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT441088	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT503080	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT503079	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT441089	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT503078	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT503077	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT480524	hsa-miR-3609	PAR-CLIP	24398324
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	24398324
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	24398324
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	24398324
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	24398324
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	24398324
MIRT480518	hsa-miR-329-5p	PAR-CLIP	24398324
MIRT480517	hsa-miR-657	PAR-CLIP	24398324
MIRT480524	hsa-miR-3609	PAR-CLIP	23592263
MIRT480523	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT480522	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT480521	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT480520	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT480519	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT480518	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT480517	hsa-miR-657	PAR-CLIP	23592263
MIRT441089	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT441088	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT441089	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT503082	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT503079	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT503077	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT503081	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT728166	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728167	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728165	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728164	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT441088	hsa-miR-20a-5p	HITS-CLIP	22473208

Transcription factors

Transcription factor	Regulation	Reference
ETS1	Unknown	24582497

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16615912, 25416956, 32296183, 35512704
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0042802	Function	Identical protein binding	IEA

Other IDs

• MIM: 608574
• HGNC: 18071
• e!Ensembl: ENSG00000158636

Protein

• UniProt ID: Q7Z589
• Protein name: BRCA2-interacting transcriptional repressor EMSY
• Protein function: Regulator which is able to repress transcription, possibly via its interaction with a multiprotein chromatin remodeling complex that modifies the chromatin (PubMed:14651845). Its interaction with BRCA2 suggests that it may play a central role in
• PDB: 1UTU, 1UZ3, 2FMM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03735	ENT	17 → 86	ENT domain	Family

• Sequence:

  MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSIST
  ERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVA
  NAAIQHNASLPVPAETGSKEVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASNVVV
  LPSGSTVYVKSVSCSDEDEKPRKRRRTNSSSSSPVVLKEVPKAVVPVSKTITVPVSGSPK
  MSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQKVIIVTTSPSSTFVPNILSKSHNY
  AAVTKLVPTSVIASTTQKPPVVITASQSSLVSNSSSGSSSSTPSPIPNTVAVTAVVSSTP
  SVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPTQILAQFPKQHQQSPKQQLYQVQQQTQ
  QQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKIITQQVQPSKILPKPVTATLPTS
  SNSPIMVVSSNGAIMTTKLVTTPTGTQATYTRPTVSPSIGRMAATPGAATYVKTTSGSII
  TVVPKSLATLGGKIISSNIVSGTTTKITTIPMTSKPNVIVVQKTTGKGTTIQGLPGKNVV
  TTLLNAGGEKTIQTVPTGAKPAILTATRPITKMIVTQPKGIGSTVQPAAKIIPTKIVYGQ
  QGKTQVLIKPKPVTFQATVVSEQTRQLVTETLQQASRVAEAGNSSIQEGKEEPQNYTDSS
  SSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKALL
  ELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTER
  TDEGTEVAFPLLVSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKSIPASSPGAITHI
  MQQALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLE
  QTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQH
  TQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLPKLQQAPNQPKIYVQPQTPQSQMSL
  PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQA
  SEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATSMLTGEAGSLPSTHMVVAGMANS
  TPQQQKCRESCSSPSTVGSSLTTRKIDPPAVPATGQFMRIQNVGQKKAEESPAEIIIQAI
  PQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDEETAMEQDIDSSTEDGTEPSPSQSSAE
  RS

• Sequence length: 1322

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMSY-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23439055, 30170133		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23439055, 31812328		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26119467, 30373671, 33213402	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	31036433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	25407941	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	21327470, 28738860		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15318925, 16145051, 18393977, 19636701, 21327470, 24582497, 28738860		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19636701		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14651845, 16029503, 20003265, 20473280, 21409565, 24641409, 26841866, 28738860	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms, Male	Neoplasm of male breast	BEFREE	27628328		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28742699	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16236351		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28824300		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	27628328		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30640700	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	16236351		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14651845, 16029503, 16236351, 18314909, 20349280, 21409565, 28738860, 31154673		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	31812328		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	21409565	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21830272	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	21830272	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29720118		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21830272, 23665963		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21830272, 23665963	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	31158401	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22036096, 23439055, 31158401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	23042114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	BEFREE	22036096, 23439055, 31158401		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	23042114		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25407941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	25407941	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	BEFREE	26258919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graft vs Host Disease	Graft-versus-host disease	Pubtator	30640700	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16029503, 16615912, 28738860, 28824300, 31154673	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	21409565		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21409565	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28824300	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24641409	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15318925, 16145051, 18393977, 19636701, 21327470, 22527098, 24582497, 28738860		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19636701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28824300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14651841, 14651845, 16029503, 16236351, 18314909, 20349280, 21409565, 24582497, 28738860, 28824300, 31154673		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24609898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21064104, 23830236, 27113481		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24609898		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19636701		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16145051		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19636701		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21327470		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19636701		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15355907, 19636701, 21327470, 21735447, 24609898		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	18393977		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31154673		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14651845, 16029503, 16236351, 18314909, 20349280, 21409565, 28738860		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14651845, 16029503, 16236351, 18314909		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14651845, 16029503, 28738860, 31154673	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18787380		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21064104, 23830236, 27113481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32800727	Associate	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15355907, 19636701, 24582497, 26841866		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18787380		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	16236351		★☆☆☆☆ Found in Text Mining only