Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56943
Gene name	ENY2 transcription and export complex 2 subunit
Gene symbol	ENY2
Synonyms (NCBI Gene)	DC6Sus1e(y)2
Chromosome	8
Chromosome location	8q23.1

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031484	hsa-miR-16-5p	Proteomics	18668040
MIRT964940	hsa-miR-1207-3p	CLIP-seq
MIRT964941	hsa-miR-1272	CLIP-seq
MIRT964942	hsa-miR-146a	CLIP-seq
MIRT964943	hsa-miR-146b-5p	CLIP-seq
MIRT964944	hsa-miR-183	CLIP-seq
MIRT964945	hsa-miR-196a	CLIP-seq
MIRT964946	hsa-miR-196b	CLIP-seq
MIRT964947	hsa-miR-2117	CLIP-seq
MIRT964948	hsa-miR-302f	CLIP-seq
MIRT964949	hsa-miR-31	CLIP-seq
MIRT964950	hsa-miR-3145-5p	CLIP-seq
MIRT964951	hsa-miR-320a	CLIP-seq
MIRT964952	hsa-miR-320b	CLIP-seq
MIRT964953	hsa-miR-320c	CLIP-seq
MIRT964954	hsa-miR-320d	CLIP-seq
MIRT964955	hsa-miR-3682-5p	CLIP-seq
MIRT964956	hsa-miR-3919	CLIP-seq
MIRT964957	hsa-miR-3925-5p	CLIP-seq
MIRT964958	hsa-miR-3927	CLIP-seq
MIRT964959	hsa-miR-3942-3p	CLIP-seq
MIRT964960	hsa-miR-4273	CLIP-seq
MIRT964961	hsa-miR-4275	CLIP-seq
MIRT964962	hsa-miR-4429	CLIP-seq
MIRT964963	hsa-miR-4679	CLIP-seq
MIRT964964	hsa-miR-508-5p	CLIP-seq
MIRT964965	hsa-miR-513c	CLIP-seq
MIRT964966	hsa-miR-514b-5p	CLIP-seq
MIRT964967	hsa-miR-548aa	CLIP-seq
MIRT964968	hsa-miR-548m	CLIP-seq
MIRT964969	hsa-miR-548p	CLIP-seq
MIRT964970	hsa-miR-944	CLIP-seq
MIRT964971	hsa-let-7a	CLIP-seq
MIRT964972	hsa-let-7b	CLIP-seq
MIRT964973	hsa-let-7c	CLIP-seq
MIRT964974	hsa-let-7d	CLIP-seq
MIRT964975	hsa-let-7e	CLIP-seq
MIRT964976	hsa-let-7f	CLIP-seq
MIRT964977	hsa-let-7g	CLIP-seq
MIRT964978	hsa-let-7i	CLIP-seq
MIRT964940	hsa-miR-1207-3p	CLIP-seq
MIRT964979	hsa-miR-1290	CLIP-seq
MIRT964980	hsa-miR-1304	CLIP-seq
MIRT964942	hsa-miR-146a	CLIP-seq
MIRT964943	hsa-miR-146b-5p	CLIP-seq
MIRT964981	hsa-miR-202	CLIP-seq
MIRT964982	hsa-miR-2909	CLIP-seq
MIRT964983	hsa-miR-3122	CLIP-seq
MIRT964984	hsa-miR-3148	CLIP-seq
MIRT964985	hsa-miR-3153	CLIP-seq
MIRT964986	hsa-miR-3162-5p	CLIP-seq
MIRT964987	hsa-miR-3163	CLIP-seq
MIRT964988	hsa-miR-3179	CLIP-seq
MIRT964955	hsa-miR-3682-5p	CLIP-seq
MIRT964989	hsa-miR-3913-5p	CLIP-seq
MIRT964956	hsa-miR-3919	CLIP-seq
MIRT964957	hsa-miR-3925-5p	CLIP-seq
MIRT964990	hsa-miR-4314	CLIP-seq
MIRT964991	hsa-miR-4458	CLIP-seq
MIRT964992	hsa-miR-4470	CLIP-seq
MIRT964993	hsa-miR-4500	CLIP-seq
MIRT964994	hsa-miR-4539	CLIP-seq
MIRT964995	hsa-miR-4668-5p	CLIP-seq
MIRT964996	hsa-miR-4680-5p	CLIP-seq
MIRT964997	hsa-miR-4712-3p	CLIP-seq
MIRT964998	hsa-miR-4714-5p	CLIP-seq
MIRT964999	hsa-miR-494	CLIP-seq
MIRT965000	hsa-miR-539	CLIP-seq
MIRT965001	hsa-miR-548c-3p	CLIP-seq
MIRT965002	hsa-miR-98	CLIP-seq
MIRT1985966	hsa-miR-192	CLIP-seq
MIRT1985967	hsa-miR-215	CLIP-seq
MIRT1985968	hsa-miR-299-3p	CLIP-seq
MIRT1985969	hsa-miR-4491	CLIP-seq
MIRT1985970	hsa-miR-4657	CLIP-seq
MIRT1985971	hsa-miR-491-5p	CLIP-seq
MIRT1985972	hsa-miR-526b	CLIP-seq
MIRT1985973	hsa-miR-578	CLIP-seq
MIRT2220407	hsa-miR-2392	CLIP-seq
MIRT2220408	hsa-miR-1298	CLIP-seq
MIRT964942	hsa-miR-146a	CLIP-seq
MIRT964943	hsa-miR-146b-5p	CLIP-seq
MIRT1985966	hsa-miR-192	CLIP-seq
MIRT1985967	hsa-miR-215	CLIP-seq
MIRT2220409	hsa-miR-224	CLIP-seq
MIRT2220410	hsa-miR-298	CLIP-seq
MIRT1985968	hsa-miR-299-3p	CLIP-seq
MIRT2220411	hsa-miR-3151	CLIP-seq
MIRT2220412	hsa-miR-3180-5p	CLIP-seq
MIRT2220413	hsa-miR-338-3p	CLIP-seq
MIRT964956	hsa-miR-3919	CLIP-seq
MIRT964957	hsa-miR-3925-5p	CLIP-seq
MIRT2220414	hsa-miR-4310	CLIP-seq
MIRT2220415	hsa-miR-4447	CLIP-seq
MIRT2220416	hsa-miR-4472	CLIP-seq
MIRT1985969	hsa-miR-4491	CLIP-seq
MIRT2220417	hsa-miR-4530	CLIP-seq
MIRT1985970	hsa-miR-4657	CLIP-seq
MIRT2220418	hsa-miR-4727-3p	CLIP-seq
MIRT1985971	hsa-miR-491-5p	CLIP-seq
MIRT1985972	hsa-miR-526b	CLIP-seq
MIRT1985973	hsa-miR-578	CLIP-seq
MIRT2220419	hsa-miR-922	CLIP-seq
MIRT964979	hsa-miR-1290	CLIP-seq
MIRT964983	hsa-miR-3122	CLIP-seq
MIRT964985	hsa-miR-3153	CLIP-seq
MIRT2524233	hsa-miR-3613-3p	CLIP-seq
MIRT964989	hsa-miR-3913-5p	CLIP-seq
MIRT964995	hsa-miR-4668-5p	CLIP-seq
MIRT2524234	hsa-miR-485-3p	CLIP-seq
MIRT2524235	hsa-miR-487a	CLIP-seq
MIRT2524236	hsa-miR-541	CLIP-seq
MIRT2524237	hsa-miR-548a-3p	CLIP-seq
MIRT2524238	hsa-miR-548e	CLIP-seq
MIRT2524239	hsa-miR-548f	CLIP-seq
MIRT2524240	hsa-miR-548g	CLIP-seq
MIRT2524241	hsa-miR-552	CLIP-seq
MIRT2524242	hsa-miR-570	CLIP-seq
MIRT2524243	hsa-miR-654-5p	CLIP-seq
MIRT2524236	hsa-miR-541	CLIP-seq
MIRT2524241	hsa-miR-552	CLIP-seq
MIRT2524243	hsa-miR-654-5p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000124	Component	SAGA complex	IBA
GO:0000124	Component	SAGA complex	IDA	18206972, 23591820, 27601583
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	19114550
GO:0003682	Function	Chromatin binding	IBA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	18206972
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	23591820, 24981860, 27601583, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005643	Component	Nuclear pore	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0006406	Process	MRNA export from nucleus	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IBA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IMP	23591820
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0044615	Component	Nuclear pore nuclear basket	IDA	23591820
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18206972
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0051028	Process	MRNA transport	IEA
GO:0061179	Process	Negative regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0070390	Component	Transcription export complex 2	IDA	23591820
GO:0070390	Component	Transcription export complex 2	IEA
GO:0071819	Component	DUBm complex	IBA
GO:0071819	Component	DUBm complex	IDA	27601583
GO:0071819	Component	DUBm complex	IEA

MIM	HGNC	e!Ensembl
619015	24449	ENSG00000120533

Q9NPA8

Protein name

Transcription and mRNA export factor ENY2 (Enhancer of yellow 2 transcription factor homolog)

Protein function

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by re

PDB

4DHX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10163	EnY2	13 → 95	Transcription factor e(y)2	Family

Sequence

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLE
HVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL

Sequence length

101

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SYSTEM ATROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	22961600	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23057668	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23057668	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22961600	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27132940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27132940	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30977117	★★★★★ ★☆☆☆☆ Found in Text Mining only

ENY2 (ENY2 transcription and export complex 2 subunit)