DUSP22 (dual specificity phosphatase 22)

Gene

• Entrez ID: 56940
• Gene name: Dual specificity phosphatase 22
• Gene symbol: DUSP22
• Synonyms (NCBI Gene): JKAP, JSP-1, JSP1, LMW-DSP2, LMWDSP2, MKP-x, MKPX, VHX
• Chromosome: 6
• Chromosome location: 6p25.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019217	hsa-miR-335-5p	Microarray	18185580
MIRT030306	hsa-miR-26b-5p	Microarray	19088304
MIRT658847	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT658846	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT658845	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT658844	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT658843	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT658842	hsa-miR-139-5p	HITS-CLIP	23824327
MIRT658841	hsa-miR-4497	HITS-CLIP	23824327
MIRT658840	hsa-miR-1180-3p	HITS-CLIP	23824327
MIRT658839	hsa-miR-4664-3p	HITS-CLIP	23824327
MIRT658847	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT658846	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT658845	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT658844	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT658843	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT658842	hsa-miR-139-5p	HITS-CLIP	23824327
MIRT658841	hsa-miR-4497	HITS-CLIP	23824327
MIRT658840	hsa-miR-1180-3p	HITS-CLIP	23824327
MIRT658839	hsa-miR-4664-3p	HITS-CLIP	23824327
MIRT2215813	hsa-miR-4756-3p	CLIP-seq
MIRT2387154	hsa-miR-548aa	CLIP-seq
MIRT2520030	hsa-miR-1226	CLIP-seq
MIRT2520031	hsa-miR-1271	CLIP-seq
MIRT2520032	hsa-miR-182	CLIP-seq
MIRT2520033	hsa-miR-186	CLIP-seq
MIRT2520034	hsa-miR-29a	CLIP-seq
MIRT2520035	hsa-miR-29b	CLIP-seq
MIRT2520036	hsa-miR-29c	CLIP-seq
MIRT2520037	hsa-miR-3065-3p	CLIP-seq
MIRT2520038	hsa-miR-3133	CLIP-seq
MIRT2520039	hsa-miR-3140-3p	CLIP-seq
MIRT2520040	hsa-miR-3168	CLIP-seq
MIRT2520041	hsa-miR-362-5p	CLIP-seq
MIRT2520042	hsa-miR-3664-5p	CLIP-seq
MIRT2520043	hsa-miR-3936	CLIP-seq
MIRT2520044	hsa-miR-4450	CLIP-seq
MIRT2520045	hsa-miR-450b-5p	CLIP-seq
MIRT2520046	hsa-miR-4519	CLIP-seq
MIRT2520047	hsa-miR-4639-5p	CLIP-seq
MIRT2520048	hsa-miR-4668-5p	CLIP-seq
MIRT2520049	hsa-miR-4744	CLIP-seq
MIRT2520050	hsa-miR-4753-3p	CLIP-seq
MIRT2520051	hsa-miR-4768-5p	CLIP-seq
MIRT2520052	hsa-miR-4781-3p	CLIP-seq
MIRT2520053	hsa-miR-491-5p	CLIP-seq
MIRT2520054	hsa-miR-500b	CLIP-seq
MIRT2520055	hsa-miR-501-5p	CLIP-seq
MIRT2520056	hsa-miR-513c	CLIP-seq
MIRT2520057	hsa-miR-514b-5p	CLIP-seq
MIRT2520058	hsa-miR-618	CLIP-seq
MIRT2520059	hsa-miR-629	CLIP-seq
MIRT2520060	hsa-miR-885-3p	CLIP-seq
MIRT2520061	hsa-miR-96	CLIP-seq
MIRT2520043	hsa-miR-3936	CLIP-seq
MIRT2520044	hsa-miR-4450	CLIP-seq
MIRT2520046	hsa-miR-4519	CLIP-seq
MIRT2520048	hsa-miR-4668-5p	CLIP-seq
MIRT2520053	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	16636663
GO:0002376	Process	Immune system process	IEA
GO:0002710	Process	Negative regulation of T cell mediated immunity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	24714587
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004726	Function	Non-membrane spanning protein tyrosine phosphatase activity	IDA	20018849
GO:0005737	Component	Cytoplasm	IDA	20018849
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24714587
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	38225265
GO:0016787	Function	Hydrolase activity	IEA
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IDA	20018849
GO:0030336	Process	Negative regulation of cell migration	IMP	20018849
GO:0031941	Component	Filamentous actin	IDA	20018849
GO:0035556	Process	Intracellular signal transduction	IDA	20018849
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	8943371
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IDA	38225265
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0051895	Process	Negative regulation of focal adhesion assembly	IDA	20018849
GO:0061851	Component	Leading edge of lamellipodium	IDA	20018849
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	38225265
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	38225265
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	20018849
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24714587

Other IDs

• MIM: 616778
• HGNC: 16077
• e!Ensembl: ENSG00000112679

Protein

• UniProt ID: Q9NRW4
• Protein name: Dual specificity protein phosphatase 22 (EC 3.1.3.16) (EC 3.1.3.48) (JNK pathway associated phosphatase) (JKAP) (JNK-stimulatory phosphatase-1) (JSP-1) (Low molecular weight dual specificity phosphatase 2) (LMW-DSP2) (Mitogen-activated protein kinase phos
• Protein function: Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues (PubMed:24714587, PubMed:38225265). Activates the JNK signaling pathway (PubMed:11717427). Inhibits T-cell receptor signaling a
• PDB: 1WRM, 4WOH, 6L1S, 6LMY, 6LOT, 6LOU, 6LVQ, 7C8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00782	DSPc	12 → 141	Dual specificity phosphatase, catalytic domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas. {ECO:0000269|PubMed:11717427}.
• Sequence:

  MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
  QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
  GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF
  LRRL

• Sequence length: 184

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUSP22-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24436131	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	26431836		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31693867		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29287311, 33547838	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34811816	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24714587		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	35908771	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17384676		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17384676	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31142510		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	34791573	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	25053874		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28017968		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35908771	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26032091		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26032091	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31415355, 35908771	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32075680	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	34699105	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28725226		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31185018, 35018451, 35908771	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21030553, 25390351, 26379151, 26431836, 30093402, 31570354, 31706671		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31766293		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31488561		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34699105	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	22388754, 27626696, 34622970	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31570354		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31570354	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17384676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31142510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31693867		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30536326		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26032091, 31142510		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17384676		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28901451	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34699105	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26032091, 27626696, 28017968, 31142510		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31281493		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32075680	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34289265	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27626696		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31693867		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34918391	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29287311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	31206807		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	30536326	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35018451	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30536326		★☆☆☆☆ Found in Text Mining only