Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	56925
Gene name	Latexin
Gene symbol	LXN
Synonyms (NCBI Gene)	ECITCI
Chromosome	3
Chromosome location	3q25.32
Summary	This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because o

Show/Hide all (68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049272	hsa-miR-92a-3p	CLASH	23622248
MIRT1122687	hsa-miR-106a	CLIP-seq
MIRT1122688	hsa-miR-106b	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122690	hsa-miR-145	CLIP-seq
MIRT1122691	hsa-miR-17	CLIP-seq
MIRT1122692	hsa-miR-1825	CLIP-seq
MIRT1122693	hsa-miR-199a-5p	CLIP-seq
MIRT1122694	hsa-miR-199b-5p	CLIP-seq
MIRT1122695	hsa-miR-20a	CLIP-seq
MIRT1122696	hsa-miR-20b	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122701	hsa-miR-3609	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122703	hsa-miR-410	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT1122705	hsa-miR-4729	CLIP-seq
MIRT1122706	hsa-miR-4796-3p	CLIP-seq
MIRT1122707	hsa-miR-519d	CLIP-seq
MIRT1122708	hsa-miR-548ah	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT1122710	hsa-miR-93	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT2034678	hsa-miR-3617	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2034680	hsa-miR-641	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT2564194	hsa-miR-1183	CLIP-seq
MIRT2564195	hsa-miR-1284	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT2564196	hsa-miR-3168	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2564197	hsa-miR-4642	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2564198	hsa-miR-561	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq
MIRT2564194	hsa-miR-1183	CLIP-seq
MIRT2564195	hsa-miR-1284	CLIP-seq
MIRT1122689	hsa-miR-142-5p	CLIP-seq
MIRT1122697	hsa-miR-3117-5p	CLIP-seq
MIRT1122698	hsa-miR-3122	CLIP-seq
MIRT1122699	hsa-miR-3149	CLIP-seq
MIRT2564196	hsa-miR-3168	CLIP-seq
MIRT1122700	hsa-miR-340	CLIP-seq
MIRT1122702	hsa-miR-3913-5p	CLIP-seq
MIRT1122704	hsa-miR-450b-3p	CLIP-seq
MIRT2564197	hsa-miR-4642	CLIP-seq
MIRT2034679	hsa-miR-4757-5p	CLIP-seq
MIRT2564198	hsa-miR-561	CLIP-seq
MIRT1122709	hsa-miR-769-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
KLF4	Repression	23364479
NANOG	Repression	23364479

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA

MIM	HGNC	e!Ensembl
609305	13347	ENSG00000079257

Q9BS40

Protein name

Latexin (Endogenous carboxypeptidase inhibitor) (ECI) (Protein MUM) (Tissue carboxypeptidase inhibitor) (TCI)

Protein function

Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation.

PDB

2BO9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06907	Latexin	3 → 219	Latexin	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain. {ECO:0000269|PubMed:11455960}.

Sequence

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Sequence length

222

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHROMOSOMAL INSTABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	30914656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31163629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24769471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29751240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30958025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23992744, 24884516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21466706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26530530	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29212624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23748736, 28114408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20068178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined Oxidative Phosphorylation Deficiency 1	Combined Oxidative Phosphorylation Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31011259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18349696, 28135275, 29092782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29706020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29706020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39202445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23028717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23028717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24769471		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23028717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24399246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21466706, 23028717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23992744, 24884516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25551472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28087740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21466706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23028717, 24399246, 30914656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18664619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17145863, 23752306, 27234159, 30089785		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	17145863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	18349696, 28135275, 29092782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	39202445	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30291024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18664619, 21466706, 23028717, 23752306, 24399246, 25977172, 28666747, 30914656		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	15108187, 15599377, 19199283, 29102897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	17690945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36949500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25551472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26530530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	29724386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28087740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27906804		★★★★★ ★☆☆☆☆ Found in Text Mining only

LXN (latexin)