NMUR2 (neuromedin U receptor 2)

Gene

• Entrez ID: 56923
• Gene name: Neuromedin U receptor 2
• Gene symbol: NMUR2
• Synonyms (NCBI Gene): FM-4, FM4, NMU-R2, NMU2R, TGR-1, TGR1
• Chromosome: 5
• Chromosome location: 5q33.1
• Summary: This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the r

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT2054521	hsa-miR-532-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT2283590	hsa-miR-3065-3p	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT2283591	hsa-miR-3688-3p	CLIP-seq
MIRT2283592	hsa-miR-4282	CLIP-seq
MIRT2283593	hsa-miR-4291	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT2054521	hsa-miR-532-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq
MIRT2283594	hsa-miR-587	CLIP-seq
MIRT2283595	hsa-miR-885-5p	CLIP-seq
MIRT1188107	hsa-miR-3616-5p	CLIP-seq
MIRT1188108	hsa-miR-3647-5p	CLIP-seq
MIRT1188109	hsa-miR-3663-3p	CLIP-seq
MIRT1188110	hsa-miR-4795-5p	CLIP-seq
MIRT1188111	hsa-miR-4797-5p	CLIP-seq
MIRT1188112	hsa-miR-573	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001607	Function	Neuromedin U receptor activity	IDA	10887190, 10894543
GO:0001607	Function	Neuromedin U receptor activity	IEA
GO:0002023	Process	Reduction of food intake in response to dietary excess	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10894543
GO:0005229	Function	Intracellularly calcium-gated chloride channel activity	IDA	10899166
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005525	Function	GTP binding	IDA	10899166
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006821	Process	Chloride transport	IEA
GO:0006940	Process	Regulation of smooth muscle contraction	NAS	10887190
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	10899166
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	10894543
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	10894543
GO:0007267	Process	Cell-cell signaling	TAS	10894543
GO:0007417	Process	Central nervous system development	TAS	10894543
GO:0007625	Process	Grooming behavior	IEA
GO:0007631	Process	Feeding behavior	TAS	10894543
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0016020	Component	Membrane	IDA	10899166
GO:0016020	Component	Membrane	IEA
GO:0042924	Function	Neuromedin U binding	IDA	10894543, 10899166
GO:0042924	Function	Neuromedin U binding	IEA
GO:0048265	Process	Response to pain	IEA
GO:0050482	Process	Arachidonate secretion	IDA	10887190
GO:0050850	Process	Positive regulation of calcium-mediated signaling	NAS	10899166
GO:1902476	Process	Chloride transmembrane transport	IEA

Other IDs

• MIM: 605108
• HGNC: 16454
• e!Ensembl: ENSG00000132911

Protein

• UniProt ID: Q9GZQ4
• Protein name: Neuromedin-U receptor 2 (NMU-R2) (G-protein coupled receptor FM-4) (G-protein coupled receptor TGR-1)
• Protein function: Receptor for the neuromedin-U and neuromedin-S neuropeptides.
• PDB: 7W55, 7W57, 7XK8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	62 → 327	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in the CNS, particularly in the medulla oblongata, pontine reticular formation, spinal cord, and thalamus. High level in testis whereas lower levels are present in a variety of peripheral tissues including the g
• Sequence:

  MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVVYVPIFVVGV
  IGNVLVCLVILQHQAMKTPTNYYLFSLAVSDLLVLLLGMPLEVYEMWRNYPFLFGPVGCY
  FKTALFETVCFASILSITTVSVERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLP
  NTSIHGIKFHYFPNGSLVPGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMA
  LRLKKDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFVEEWSES
  LAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPA
  QRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT

• Sequence length: 415

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia	Anorexia	BEFREE	28757640		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36543808	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28423716		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28423716	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26317338	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34493299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28935264		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28935264		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26167956		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26167956		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30914203		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28423716		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28423716		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31765157		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	30266756		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15525579, 16111886, 28757640, 28935264, 31765157		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36232539	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36232539	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26317338	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36543808	Inhibit	★☆☆☆☆ Found in Text Mining only