Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56913
Gene name	Core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Gene symbol	C1GALT1
Synonyms (NCBI Gene)	C1GALTT-synthase
Chromosome	7
Chromosome location	7p22.1-p21.3
Summary	The protein encoded by this gene generates the common core 1 O-glycan structure, Gal-beta-1-3GalNAc-R, by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R. Core 1 is a precursor for many extended mucin-type O-glycans on cell surface and secreted glyco

351

Show/Hide all (351)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019301	hsa-miR-148b-3p	Microarray	17612493
MIRT019740	hsa-miR-375	Microarray	20215506
MIRT027469	hsa-miR-98-5p	Microarray	19088304
MIRT052502	hsa-let-7a-5p	CLASH	23622248
MIRT052034	hsa-let-7b-5p	CLASH	23622248
MIRT688902	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT688901	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT688900	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT688899	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT688898	hsa-miR-4445-3p	HITS-CLIP	23313552
MIRT688897	hsa-miR-548al	HITS-CLIP	23313552
MIRT688896	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT688895	hsa-miR-4421	HITS-CLIP	23313552
MIRT688894	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT688893	hsa-miR-3926	HITS-CLIP	23313552
MIRT688892	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT688891	hsa-miR-548s	HITS-CLIP	23313552
MIRT660023	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT660021	hsa-miR-8063	HITS-CLIP	23824327
MIRT660022	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT660020	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT660019	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT660017	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT660015	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT660023	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT660021	hsa-miR-8063	HITS-CLIP	23824327
MIRT660022	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT660020	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT660019	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT660018	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT660017	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT660015	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT027469	hsa-miR-98-5p	Luciferase reporter assayWestern blottingqRT-PCR	33935780
MIRT688902	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT688901	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT688900	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT688899	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT688898	hsa-miR-4445-3p	HITS-CLIP	23313552
MIRT688897	hsa-miR-548al	HITS-CLIP	23313552
MIRT688896	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT688895	hsa-miR-4421	HITS-CLIP	23313552
MIRT688894	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT688893	hsa-miR-3926	HITS-CLIP	23313552
MIRT688892	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT688891	hsa-miR-548s	HITS-CLIP	23313552
MIRT660023	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT660021	hsa-miR-8063	HITS-CLIP	23824327
MIRT660022	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT660020	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT660019	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT660017	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT660015	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT660023	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT660021	hsa-miR-8063	HITS-CLIP	23824327
MIRT660022	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT660020	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT660019	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT660018	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT660017	hsa-miR-196a-3p	HITS-CLIP	23824327
MIRT660015	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT839113	hsa-let-7a	CLIP-seq
MIRT839114	hsa-let-7b	CLIP-seq
MIRT839115	hsa-let-7c	CLIP-seq
MIRT839116	hsa-let-7d	CLIP-seq
MIRT839117	hsa-let-7e	CLIP-seq
MIRT839118	hsa-let-7f	CLIP-seq
MIRT839119	hsa-let-7g	CLIP-seq
MIRT839120	hsa-let-7i	CLIP-seq
MIRT839121	hsa-miR-1178	CLIP-seq
MIRT839122	hsa-miR-1273f	CLIP-seq
MIRT839123	hsa-miR-1293	CLIP-seq
MIRT839124	hsa-miR-1294	CLIP-seq
MIRT839125	hsa-miR-143	CLIP-seq
MIRT839126	hsa-miR-145	CLIP-seq
MIRT839127	hsa-miR-148a	CLIP-seq
MIRT839128	hsa-miR-148b	CLIP-seq
MIRT839129	hsa-miR-152	CLIP-seq
MIRT839130	hsa-miR-1825	CLIP-seq
MIRT839131	hsa-miR-1914	CLIP-seq
MIRT839132	hsa-miR-193a-3p	CLIP-seq
MIRT839133	hsa-miR-193b	CLIP-seq
MIRT839134	hsa-miR-196a	CLIP-seq
MIRT839135	hsa-miR-196b	CLIP-seq
MIRT839136	hsa-miR-199a-5p	CLIP-seq
MIRT839137	hsa-miR-199b-5p	CLIP-seq
MIRT839138	hsa-miR-202	CLIP-seq
MIRT839139	hsa-miR-2964a-3p	CLIP-seq
MIRT839140	hsa-miR-298	CLIP-seq
MIRT839141	hsa-miR-302f	CLIP-seq
MIRT839142	hsa-miR-3074-3p	CLIP-seq
MIRT839143	hsa-miR-3122	CLIP-seq
MIRT839144	hsa-miR-3140-3p	CLIP-seq
MIRT839145	hsa-miR-3165	CLIP-seq
MIRT839146	hsa-miR-3200-5p	CLIP-seq
MIRT839147	hsa-miR-3622a-3p	CLIP-seq
MIRT839148	hsa-miR-3622b-3p	CLIP-seq
MIRT839149	hsa-miR-3682-5p	CLIP-seq
MIRT839150	hsa-miR-377	CLIP-seq
MIRT839151	hsa-miR-3913-5p	CLIP-seq
MIRT839152	hsa-miR-3920	CLIP-seq
MIRT839153	hsa-miR-3921	CLIP-seq
MIRT839154	hsa-miR-3927	CLIP-seq
MIRT839155	hsa-miR-411	CLIP-seq
MIRT839156	hsa-miR-4251	CLIP-seq
MIRT839157	hsa-miR-4255	CLIP-seq
MIRT839158	hsa-miR-4274	CLIP-seq
MIRT839159	hsa-miR-4276	CLIP-seq
MIRT839160	hsa-miR-4282	CLIP-seq
MIRT839161	hsa-miR-4303	CLIP-seq
MIRT839162	hsa-miR-4305	CLIP-seq
MIRT839163	hsa-miR-4316	CLIP-seq
MIRT839164	hsa-miR-4326	CLIP-seq
MIRT839165	hsa-miR-4328	CLIP-seq
MIRT839166	hsa-miR-4329	CLIP-seq
MIRT839167	hsa-miR-4418	CLIP-seq
MIRT839168	hsa-miR-4433	CLIP-seq
MIRT839169	hsa-miR-4446-5p	CLIP-seq
MIRT839170	hsa-miR-4458	CLIP-seq
MIRT839171	hsa-miR-4459	CLIP-seq
MIRT839172	hsa-miR-4480	CLIP-seq
MIRT839173	hsa-miR-4483	CLIP-seq
MIRT839174	hsa-miR-4500	CLIP-seq
MIRT839175	hsa-miR-450b-3p	CLIP-seq
MIRT839176	hsa-miR-4519	CLIP-seq
MIRT839177	hsa-miR-4524	CLIP-seq
MIRT839178	hsa-miR-455-3p	CLIP-seq
MIRT839179	hsa-miR-4653-5p	CLIP-seq
MIRT839180	hsa-miR-4668-3p	CLIP-seq
MIRT839181	hsa-miR-4677-3p	CLIP-seq
MIRT839182	hsa-miR-4694-3p	CLIP-seq
MIRT839183	hsa-miR-4701-5p	CLIP-seq
MIRT839184	hsa-miR-4708-5p	CLIP-seq
MIRT839185	hsa-miR-4711-5p	CLIP-seq
MIRT839186	hsa-miR-4731-3p	CLIP-seq
MIRT839187	hsa-miR-4740-3p	CLIP-seq
MIRT839188	hsa-miR-4755-5p	CLIP-seq
MIRT839189	hsa-miR-4761-5p	CLIP-seq
MIRT839190	hsa-miR-4766-3p	CLIP-seq
MIRT839191	hsa-miR-4768-3p	CLIP-seq
MIRT839192	hsa-miR-4770	CLIP-seq
MIRT839193	hsa-miR-4775	CLIP-seq
MIRT839194	hsa-miR-4801	CLIP-seq
MIRT839195	hsa-miR-485-5p	CLIP-seq
MIRT839196	hsa-miR-487a	CLIP-seq
MIRT839197	hsa-miR-509-3-5p	CLIP-seq
MIRT839198	hsa-miR-509-5p	CLIP-seq
MIRT839199	hsa-miR-544b	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT839201	hsa-miR-548p	CLIP-seq
MIRT839202	hsa-miR-588	CLIP-seq
MIRT839203	hsa-miR-593	CLIP-seq
MIRT839204	hsa-miR-598	CLIP-seq
MIRT839205	hsa-miR-603	CLIP-seq
MIRT839206	hsa-miR-619	CLIP-seq
MIRT839207	hsa-miR-642a	CLIP-seq
MIRT839208	hsa-miR-769-3p	CLIP-seq
MIRT839209	hsa-miR-885-5p	CLIP-seq
MIRT839210	hsa-miR-892b	CLIP-seq
MIRT839211	hsa-miR-98	CLIP-seq
MIRT1948799	hsa-miR-1208	CLIP-seq
MIRT839123	hsa-miR-1293	CLIP-seq
MIRT1948800	hsa-miR-1298	CLIP-seq
MIRT1948801	hsa-miR-3117-5p	CLIP-seq
MIRT839145	hsa-miR-3165	CLIP-seq
MIRT1948802	hsa-miR-337-3p	CLIP-seq
MIRT1948803	hsa-miR-338-5p	CLIP-seq
MIRT1948804	hsa-miR-340	CLIP-seq
MIRT1948805	hsa-miR-345	CLIP-seq
MIRT1948806	hsa-miR-34b	CLIP-seq
MIRT1948807	hsa-miR-3591-3p	CLIP-seq
MIRT839147	hsa-miR-3622a-3p	CLIP-seq
MIRT839148	hsa-miR-3622b-3p	CLIP-seq
MIRT1948808	hsa-miR-371-5p	CLIP-seq
MIRT1948809	hsa-miR-371b-5p	CLIP-seq
MIRT1948810	hsa-miR-3922-5p	CLIP-seq
MIRT1948811	hsa-miR-3924	CLIP-seq
MIRT1948812	hsa-miR-4256	CLIP-seq
MIRT839159	hsa-miR-4276	CLIP-seq
MIRT839160	hsa-miR-4282	CLIP-seq
MIRT1948813	hsa-miR-4307	CLIP-seq
MIRT1948814	hsa-miR-4310	CLIP-seq
MIRT1948815	hsa-miR-4422	CLIP-seq
MIRT839168	hsa-miR-4433	CLIP-seq
MIRT839171	hsa-miR-4459	CLIP-seq
MIRT839172	hsa-miR-4480	CLIP-seq
MIRT839173	hsa-miR-4483	CLIP-seq
MIRT1948816	hsa-miR-4503	CLIP-seq
MIRT1948817	hsa-miR-4504	CLIP-seq
MIRT1948818	hsa-miR-4522	CLIP-seq
MIRT1948819	hsa-miR-4641	CLIP-seq
MIRT1948820	hsa-miR-4645-3p	CLIP-seq
MIRT1948821	hsa-miR-4661-5p	CLIP-seq
MIRT1948822	hsa-miR-4704-3p	CLIP-seq
MIRT1948823	hsa-miR-4729	CLIP-seq
MIRT1948824	hsa-miR-4733-3p	CLIP-seq
MIRT839189	hsa-miR-4761-5p	CLIP-seq
MIRT1948825	hsa-miR-4762-3p	CLIP-seq
MIRT839191	hsa-miR-4768-3p	CLIP-seq
MIRT839193	hsa-miR-4775	CLIP-seq
MIRT1948826	hsa-miR-4797-3p	CLIP-seq
MIRT1948827	hsa-miR-488	CLIP-seq
MIRT1948828	hsa-miR-494	CLIP-seq
MIRT1948829	hsa-miR-499a-5p	CLIP-seq
MIRT1948830	hsa-miR-513a-3p	CLIP-seq
MIRT1948831	hsa-miR-514	CLIP-seq
MIRT1948832	hsa-miR-514b-3p	CLIP-seq
MIRT1948833	hsa-miR-518d-5p	CLIP-seq
MIRT1948834	hsa-miR-519b-5p	CLIP-seq
MIRT1948835	hsa-miR-519c-5p	CLIP-seq
MIRT1948836	hsa-miR-520c-5p	CLIP-seq
MIRT1948837	hsa-miR-526a	CLIP-seq
MIRT1948838	hsa-miR-542-3p	CLIP-seq
MIRT1948839	hsa-miR-543	CLIP-seq
MIRT839199	hsa-miR-544b	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT1948840	hsa-miR-590-3p	CLIP-seq
MIRT1948841	hsa-miR-758	CLIP-seq
MIRT839113	hsa-let-7a	CLIP-seq
MIRT839114	hsa-let-7b	CLIP-seq
MIRT839115	hsa-let-7c	CLIP-seq
MIRT839116	hsa-let-7d	CLIP-seq
MIRT839117	hsa-let-7e	CLIP-seq
MIRT839118	hsa-let-7f	CLIP-seq
MIRT839119	hsa-let-7g	CLIP-seq
MIRT839120	hsa-let-7i	CLIP-seq
MIRT2186701	hsa-miR-1	CLIP-seq
MIRT2186702	hsa-miR-1183	CLIP-seq
MIRT2186703	hsa-miR-125a-3p	CLIP-seq
MIRT2186704	hsa-miR-1278	CLIP-seq
MIRT839123	hsa-miR-1293	CLIP-seq
MIRT839124	hsa-miR-1294	CLIP-seq
MIRT2186705	hsa-miR-1297	CLIP-seq
MIRT2186706	hsa-miR-140-3p	CLIP-seq
MIRT839127	hsa-miR-148a	CLIP-seq
MIRT839128	hsa-miR-148b	CLIP-seq
MIRT839129	hsa-miR-152	CLIP-seq
MIRT2186707	hsa-miR-155	CLIP-seq
MIRT839131	hsa-miR-1914	CLIP-seq
MIRT2186708	hsa-miR-1915	CLIP-seq
MIRT839134	hsa-miR-196a	CLIP-seq
MIRT839135	hsa-miR-196b	CLIP-seq
MIRT839138	hsa-miR-202	CLIP-seq
MIRT2186709	hsa-miR-203	CLIP-seq
MIRT2186710	hsa-miR-206	CLIP-seq
MIRT2186711	hsa-miR-26a	CLIP-seq
MIRT2186712	hsa-miR-26b	CLIP-seq
MIRT839140	hsa-miR-298	CLIP-seq
MIRT1948801	hsa-miR-3117-5p	CLIP-seq
MIRT2186713	hsa-miR-3121-3p	CLIP-seq
MIRT839143	hsa-miR-3122	CLIP-seq
MIRT2186714	hsa-miR-3147	CLIP-seq
MIRT2186715	hsa-miR-3163	CLIP-seq
MIRT839145	hsa-miR-3165	CLIP-seq
MIRT2186716	hsa-miR-3192	CLIP-seq
MIRT1948803	hsa-miR-338-5p	CLIP-seq
MIRT2186717	hsa-miR-3611	CLIP-seq
MIRT839147	hsa-miR-3622a-3p	CLIP-seq
MIRT839148	hsa-miR-3622b-3p	CLIP-seq
MIRT2186718	hsa-miR-3622b-5p	CLIP-seq
MIRT2186719	hsa-miR-3646	CLIP-seq
MIRT839149	hsa-miR-3682-5p	CLIP-seq
MIRT1948808	hsa-miR-371-5p	CLIP-seq
MIRT1948809	hsa-miR-371b-5p	CLIP-seq
MIRT839151	hsa-miR-3913-5p	CLIP-seq
MIRT839154	hsa-miR-3927	CLIP-seq
MIRT839159	hsa-miR-4276	CLIP-seq
MIRT1948814	hsa-miR-4310	CLIP-seq
MIRT839163	hsa-miR-4316	CLIP-seq
MIRT2186720	hsa-miR-4425	CLIP-seq
MIRT839168	hsa-miR-4433	CLIP-seq
MIRT839170	hsa-miR-4458	CLIP-seq
MIRT839171	hsa-miR-4459	CLIP-seq
MIRT2186721	hsa-miR-4465	CLIP-seq
MIRT839172	hsa-miR-4480	CLIP-seq
MIRT839173	hsa-miR-4483	CLIP-seq
MIRT839174	hsa-miR-4500	CLIP-seq
MIRT1948817	hsa-miR-4504	CLIP-seq
MIRT839175	hsa-miR-450b-3p	CLIP-seq
MIRT839178	hsa-miR-455-3p	CLIP-seq
MIRT2186722	hsa-miR-4637	CLIP-seq
MIRT1948821	hsa-miR-4661-5p	CLIP-seq
MIRT839180	hsa-miR-4668-3p	CLIP-seq
MIRT839181	hsa-miR-4677-3p	CLIP-seq
MIRT2186723	hsa-miR-4693-5p	CLIP-seq
MIRT2186724	hsa-miR-4697-3p	CLIP-seq
MIRT2186725	hsa-miR-4726-3p	CLIP-seq
MIRT1948823	hsa-miR-4729	CLIP-seq
MIRT2186726	hsa-miR-4744	CLIP-seq
MIRT839189	hsa-miR-4761-5p	CLIP-seq
MIRT839191	hsa-miR-4768-3p	CLIP-seq
MIRT2186727	hsa-miR-4789-3p	CLIP-seq
MIRT2186728	hsa-miR-4793-5p	CLIP-seq
MIRT1948826	hsa-miR-4797-3p	CLIP-seq
MIRT2186729	hsa-miR-4797-5p	CLIP-seq
MIRT1948839	hsa-miR-543	CLIP-seq
MIRT839199	hsa-miR-544b	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT2186730	hsa-miR-554	CLIP-seq
MIRT2186731	hsa-miR-556-3p	CLIP-seq
MIRT2186732	hsa-miR-570	CLIP-seq
MIRT839205	hsa-miR-603	CLIP-seq
MIRT2186733	hsa-miR-613	CLIP-seq
MIRT2186734	hsa-miR-656	CLIP-seq
MIRT2186735	hsa-miR-661	CLIP-seq
MIRT1948841	hsa-miR-758	CLIP-seq
MIRT2186736	hsa-miR-759	CLIP-seq
MIRT839208	hsa-miR-769-3p	CLIP-seq
MIRT2186737	hsa-miR-802	CLIP-seq
MIRT839209	hsa-miR-885-5p	CLIP-seq
MIRT839211	hsa-miR-98	CLIP-seq
MIRT2385100	hsa-miR-3688-3p	CLIP-seq
MIRT839159	hsa-miR-4276	CLIP-seq
MIRT2385101	hsa-miR-4477a	CLIP-seq
MIRT2186705	hsa-miR-1297	CLIP-seq
MIRT2186711	hsa-miR-26a	CLIP-seq
MIRT2186712	hsa-miR-26b	CLIP-seq
MIRT2426758	hsa-miR-323-3p	CLIP-seq
MIRT2426759	hsa-miR-410	CLIP-seq
MIRT2426760	hsa-miR-421	CLIP-seq
MIRT2426761	hsa-miR-4257	CLIP-seq
MIRT2186721	hsa-miR-4465	CLIP-seq
MIRT2426762	hsa-miR-4709-5p	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT2445317	hsa-miR-10a	CLIP-seq
MIRT2445318	hsa-miR-10b	CLIP-seq
MIRT2445319	hsa-miR-4517	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT2186732	hsa-miR-570	CLIP-seq
MIRT839203	hsa-miR-593	CLIP-seq
MIRT2445317	hsa-miR-10a	CLIP-seq
MIRT2445318	hsa-miR-10b	CLIP-seq
MIRT2445319	hsa-miR-4517	CLIP-seq
MIRT2490674	hsa-miR-548a-3p	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT2490675	hsa-miR-548e	CLIP-seq
MIRT2490676	hsa-miR-548f	CLIP-seq
MIRT2186732	hsa-miR-570	CLIP-seq
MIRT839203	hsa-miR-593	CLIP-seq
MIRT2445317	hsa-miR-10a	CLIP-seq
MIRT2445318	hsa-miR-10b	CLIP-seq
MIRT839143	hsa-miR-3122	CLIP-seq
MIRT839151	hsa-miR-3913-5p	CLIP-seq
MIRT839175	hsa-miR-450b-3p	CLIP-seq
MIRT2445319	hsa-miR-4517	CLIP-seq
MIRT2490674	hsa-miR-548a-3p	CLIP-seq
MIRT839200	hsa-miR-548c-3p	CLIP-seq
MIRT2490675	hsa-miR-548e	CLIP-seq
MIRT2490676	hsa-miR-548f	CLIP-seq
MIRT2186732	hsa-miR-570	CLIP-seq
MIRT839203	hsa-miR-593	CLIP-seq
MIRT839208	hsa-miR-769-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IMP	17228361
GO:0001822	Process	Kidney development	IMP	17228361
GO:0005515	Function	Protein binding	IPI	21496458
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0016020	Component	Membrane	IDA	11677243
GO:0016020	Component	Membrane	IEA
GO:0016263	Function	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity	IBA
GO:0016263	Function	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity	IDA	11677243
GO:0016263	Function	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA

MIM	HGNC	e!Ensembl
610555	24337	ENSG00000106392

Q9NS00

Protein name

Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC 2.4.1.122) (B3Gal-T8) (Core 1 O-glycan T-synthase) (Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1) (Beta-1,3-galactosyltransferase) (Core 1 beta1,3

Protein function

Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins (PubMed:11677243). Plays a central role in many processes, such as angiogenesi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02434	Fringe	84 → 272	Fringe-like	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in kidney, heart, placenta and liver. {ECO:0000269|PubMed:11677243}.

Sequence

MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLE
GQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLR
WLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKL
GNP

Sequence length

363

Interactions

View interactions

	KEGG		Reactome
	Mucin type O-glycan biosynthesis Other types of O-glycan biosynthesis Metabolic pathways		Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS) O-linked glycosylation of mucins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	31645367		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30683666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18840896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	37040171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly type A1	Brachydactyly	Pubtator	28187132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25762620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37040171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25975956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28498248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	33040455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23536887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30035127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23536887, 29999571, 30035127, 30115016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36745330	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30087707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30087707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Galactosemias	Galactosemia	Pubtator	28209808, 32677771, 33593824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	22203484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	17228361, 17315006, 19357720, 20959392, 26063800, 26125729, 28209808, 32945407, 33593824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22362909, 35987175	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29930379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29930379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	31633299	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	28187132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23624553		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	16238683, 17228361, 17315006, 18202089, 18840896, 19229831, 19357720, 22131235, 22362909, 23190752, 24271554, 26125729, 26782518, 30917363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37306210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	37306210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16238683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17062753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Hypomyelinating 4	Hypomyelinating leukodystrophy	Pubtator	37216524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23832667, 25089569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29930379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25762620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30087707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28498248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29906246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23832667, 25089569, 28498248, 29906246, 29930379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23536887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25089569, 25762620, 25975956, 29930379, 30115016		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28498248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34675409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	37306210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29906246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30076562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29930379	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29930379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tn Syndrome	Polyagglutinable erythrocyte syndrome	BEFREE	17062753, 7683697		★★★★★ ★☆☆☆☆ Found in Text Mining only

C1GALT1 (core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1)