Gene Gene information from NCBI Gene database.
Entrez ID 56910
Gene name StAR related lipid transfer domain containing 7
Gene symbol STARD7
Synonyms (NCBI Gene)
ADCMEBAFME2FAMEFAME2FCMTE2GTT1
Chromosome 2
Chromosome location 2q11.2
miRNA miRNA information provided by mirtarbase database.
1420
miRTarBase ID miRNA Experiments Reference
MIRT016336 hsa-miR-193b-3p Microarray 20304954
MIRT029080 hsa-miR-26b-5p Microarray 19088304
MIRT051638 hsa-let-7e-5p CLASH 23622248
MIRT049177 hsa-miR-92a-3p CLASH 23622248
MIRT047900 hsa-miR-30c-5p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
CTNNB1 Activation 21622533
NR5A1 Activation 21622533
TCF7L2 Activation 21622533
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0001773 Process Myeloid dendritic cell activation IEA
GO:0005515 Function Protein binding IPI 27499296, 28514442, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616712 18063 ENSG00000084090
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQZ5
Protein name StAR-related lipid transfer protein 7, mitochondrial (Gestational trophoblastic tumor protein 1) (START domain-containing protein 7) (StARD7)
Protein function May play a protective role in mucosal tissues by preventing exaggerated allergic responses.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01852 START 125 328 START domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in nasal epithelial cells. Down-regulated in nasal epithelial cells in patients experiencing an asthma exacerbation as compared to stable asthmatics and healthy controls. {ECO:0000269|PubMed:25980009}.
Sequence
MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGR
LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHH
PPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFF
NVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQEN
NMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPR
YCVSWMVSSGMPDFLEKLHMATLKAKNM
EIKVKDYISAKPLEMSSEAKATSQSSERKNEG
SCGPARIEYA
Sequence length 370
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Synthesis of PC
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Epilepsy, familial adult myoclonic, 2 Uncertain significance ClinVar
ClinVar, GWAS catalog, HPO
ClinVar, GWAS catalog, HPO
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
EPILEPSY, MYOCLONIC, BENIGN ADULT FAMILIAL, TYPE 2 CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
STARD7-related disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 30596995
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30617039
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 30371299
★☆☆☆☆
Found in Text Mining only
Benign adult familial myoclonic epilepsy Benign Myoclonic Epilepsy BEFREE 18231815
★☆☆☆☆
Found in Text Mining only
Choriocarcinoma Choriocarcinoma BEFREE 15013637
★☆☆☆☆
Found in Text Mining only
Chronic Kidney Diseases Kidney Disease BEFREE 28493452
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37191369 Stimulate
★☆☆☆☆
Found in Text Mining only
Coronary Arteriosclerosis Coronary Arteriosclerosis BEFREE 29097450, 30840026
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease BEFREE 29097450, 30596995, 30840026
★☆☆☆☆
Found in Text Mining only
Coronary heart disease Coronary Heart Disease BEFREE 29097450, 30840026
★☆☆☆☆
Found in Text Mining only