Gene Gene information from NCBI Gene database.
Entrez ID 56852
Gene name RAD18 E3 ubiquitin protein ligase
Gene symbol RAD18
Synonyms (NCBI Gene)
RNF73
Chromosome 3
Chromosome location 3p25.3
Summary The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Sim
miRNA miRNA information provided by mirtarbase database.
448
miRTarBase ID miRNA Experiments Reference
MIRT714889 hsa-miR-3129-3p HITS-CLIP 19536157
MIRT714888 hsa-miR-5583-5p HITS-CLIP 19536157
MIRT714887 hsa-miR-6779-3p HITS-CLIP 19536157
MIRT714886 hsa-miR-221-5p HITS-CLIP 19536157
MIRT714885 hsa-miR-8073 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0000403 Function Y-form DNA binding IDA 18363965
GO:0003677 Function DNA binding IEA
GO:0003684 Function Damaged DNA binding NAS 10884424
GO:0003697 Function Single-stranded DNA binding IEA
GO:0005515 Function Protein binding IPI 18316726, 18719106, 19549727, 21422291, 21659603, 22036607, 22681887, 24981860, 25416956, 25931565, 26496610, 28514442, 32296183, 32814053, 33961781, 35849344
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605256 18278 ENSG00000070950
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NS91
Protein name E3 ubiquitin-protein ligase RAD18 (EC 2.3.2.27) (Postreplication repair protein RAD18) (hHR18) (hRAD18) (RING finger protein 73) (RING-type E3 ubiquitin transferase RAD18)
Protein function E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form
PDB 2MRE , 2MRF , 2Y43 , 2YBF , 5VF0 , 8IR2 , 8IR4 , 9BD3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 24 63 Domain
PF02037 SAP 248 282 SAP domain Family
Sequence
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTC
CVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPV
ASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAP
DPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKR
KPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
VREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKG
YKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREED
SSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRA
AESAEIEPRNKRNRN
Sequence length 495
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Recognition of DNA damage by PCNA-containing replication complex
E3 ubiquitin ligases ubiquitinate target proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 19630985
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 19630985, 32319669 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 22509890
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 19630985
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 35426246 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 17914568, 25913620
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms LHGDN 17914568
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 32319669, 38073330 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Diabetes mellitus, type 2 Pubtator 29886452 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Esophageal neoplasm Pubtator 22509890 Associate
★☆☆☆☆
Found in Text Mining only