Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5685
Gene name	Proteasome 20S subunit alpha 4
Gene symbol	PSMA4
Synonyms (NCBI Gene)	HC9HsT17706PSC9
Chromosome	15
Chromosome location	15q25.1
Summary	This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq,

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049531	hsa-miR-92a-3p	CLASH	23622248
MIRT043029	hsa-miR-324-5p	CLASH	23622248
MIRT1270002	hsa-miR-142-5p	CLIP-seq
MIRT1270003	hsa-miR-208a	CLIP-seq
MIRT1270004	hsa-miR-208b	CLIP-seq
MIRT1270005	hsa-miR-3179	CLIP-seq
MIRT1270006	hsa-miR-338-5p	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270008	hsa-miR-4520a-3p	CLIP-seq
MIRT1270009	hsa-miR-4520b-3p	CLIP-seq
MIRT1270010	hsa-miR-4699-5p	CLIP-seq
MIRT1270011	hsa-miR-499-5p	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 15887188, 17948026, 19581590, 22801492, 25416956, 25599644, 25959826, 29568061, 29636472, 31473102, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337

MIM	HGNC	e!Ensembl
176846	9533	ENSG00000041357

P25789

Protein name

Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) (Proteasome subunit alpha-3) (alpha-3)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	5 → 27	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	28 → 216	Proteasome subunit	Domain

Sequence

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) Autodegradation of Cdh1 by Cdh1:APC/C SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G SCF(Skp2)-mediated degradation of p27/p21 Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of RUNX2 expression and activity Regulation of RUNX3 expression and activity Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	23980094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	35952493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35952493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	19789337, 20587604, 25744645, 29486777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29486777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23637351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35952493, 39181687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	20195826		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	18385676, 18780872, 19789337, 20587604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19789337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34629418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	20195826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19789337, 20587604, 25744645, 29486777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19789337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25744645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24518713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37219663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15866219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29422661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	22491018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	22491018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29486777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27966459	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMA4 (proteasome 20S subunit alpha 4)