Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56849
Gene name	Transcription elongation factor A like 7
Gene symbol	TCEAL7
Synonyms (NCBI Gene)	WEX5
Chromosome	X
Chromosome location	Xq22.2

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017976	hsa-miR-335-5p	Microarray	18185580
MIRT437477	hsa-miR-182-5p	5.0	24021963
MIRT1415674	hsa-miR-299-5p	CLIP-seq
MIRT1415675	hsa-miR-3689d	CLIP-seq
MIRT1415676	hsa-miR-4443	CLIP-seq
MIRT1415677	hsa-miR-579	CLIP-seq
MIRT1415674	hsa-miR-299-5p	CLIP-seq
MIRT1415675	hsa-miR-3689d	CLIP-seq
MIRT2124679	hsa-miR-450b-5p	CLIP-seq
MIRT2124680	hsa-miR-4789-5p	CLIP-seq
MIRT1415677	hsa-miR-579	CLIP-seq
MIRT2347080	hsa-miR-4317	CLIP-seq
MIRT2347081	hsa-miR-595	CLIP-seq
MIRT2639748	hsa-miR-106a	CLIP-seq
MIRT2639749	hsa-miR-106b	CLIP-seq
MIRT2639750	hsa-miR-1208	CLIP-seq
MIRT2639751	hsa-miR-1253	CLIP-seq
MIRT2639752	hsa-miR-1271	CLIP-seq
MIRT2639753	hsa-miR-1273f	CLIP-seq
MIRT2639754	hsa-miR-129-5p	CLIP-seq
MIRT2639755	hsa-miR-143	CLIP-seq
MIRT2639756	hsa-miR-17	CLIP-seq
MIRT2639757	hsa-miR-182	CLIP-seq
MIRT2639758	hsa-miR-20a	CLIP-seq
MIRT2639759	hsa-miR-20b	CLIP-seq
MIRT2639760	hsa-miR-216a	CLIP-seq
MIRT2639761	hsa-miR-219-2-3p	CLIP-seq
MIRT2639762	hsa-miR-2964a-3p	CLIP-seq
MIRT2639763	hsa-miR-31	CLIP-seq
MIRT2639764	hsa-miR-3163	CLIP-seq
MIRT2639765	hsa-miR-3166	CLIP-seq
MIRT2639766	hsa-miR-329	CLIP-seq
MIRT2639767	hsa-miR-362-3p	CLIP-seq
MIRT2639768	hsa-miR-3646	CLIP-seq
MIRT2639769	hsa-miR-3688-5p	CLIP-seq
MIRT2639770	hsa-miR-369-3p	CLIP-seq
MIRT2639771	hsa-miR-374a	CLIP-seq
MIRT2639772	hsa-miR-374b	CLIP-seq
MIRT2639773	hsa-miR-377	CLIP-seq
MIRT2639774	hsa-miR-380	CLIP-seq
MIRT2639775	hsa-miR-3941	CLIP-seq
MIRT2639776	hsa-miR-4311	CLIP-seq
MIRT2639777	hsa-miR-4420	CLIP-seq
MIRT2639778	hsa-miR-4452	CLIP-seq
MIRT2639779	hsa-miR-4477a	CLIP-seq
MIRT2639780	hsa-miR-4495	CLIP-seq
MIRT2639781	hsa-miR-4519	CLIP-seq
MIRT2639782	hsa-miR-4668-3p	CLIP-seq
MIRT2639783	hsa-miR-4708-5p	CLIP-seq
MIRT2639784	hsa-miR-4731-3p	CLIP-seq
MIRT2639785	hsa-miR-4756-3p	CLIP-seq
MIRT2639786	hsa-miR-4770	CLIP-seq
MIRT2639787	hsa-miR-4771	CLIP-seq
MIRT2639788	hsa-miR-4786-5p	CLIP-seq
MIRT2639789	hsa-miR-4789-3p	CLIP-seq
MIRT2124680	hsa-miR-4789-5p	CLIP-seq
MIRT2639790	hsa-miR-4801	CLIP-seq
MIRT2639791	hsa-miR-519a	CLIP-seq
MIRT2639792	hsa-miR-519b-3p	CLIP-seq
MIRT2639793	hsa-miR-519c-3p	CLIP-seq
MIRT2639794	hsa-miR-519d	CLIP-seq
MIRT2639795	hsa-miR-545	CLIP-seq
MIRT2639796	hsa-miR-548ad	CLIP-seq
MIRT2639797	hsa-miR-548p	CLIP-seq
MIRT2639798	hsa-miR-568	CLIP-seq
MIRT1415677	hsa-miR-579	CLIP-seq
MIRT2639799	hsa-miR-603	CLIP-seq
MIRT2639800	hsa-miR-642b	CLIP-seq
MIRT2639801	hsa-miR-664	CLIP-seq
MIRT2639802	hsa-miR-769-5p	CLIP-seq
MIRT2639803	hsa-miR-9	CLIP-seq
MIRT2639804	hsa-miR-93	CLIP-seq
MIRT2639805	hsa-miR-96	CLIP-seq
MIRT2639748	hsa-miR-106a	CLIP-seq
MIRT2639749	hsa-miR-106b	CLIP-seq
MIRT2639751	hsa-miR-1253	CLIP-seq
MIRT2639752	hsa-miR-1271	CLIP-seq
MIRT2639753	hsa-miR-1273f	CLIP-seq
MIRT2639754	hsa-miR-129-5p	CLIP-seq
MIRT2639755	hsa-miR-143	CLIP-seq
MIRT2639756	hsa-miR-17	CLIP-seq
MIRT2639757	hsa-miR-182	CLIP-seq
MIRT2639758	hsa-miR-20a	CLIP-seq
MIRT2639759	hsa-miR-20b	CLIP-seq
MIRT2639760	hsa-miR-216a	CLIP-seq
MIRT2639763	hsa-miR-31	CLIP-seq
MIRT2639765	hsa-miR-3166	CLIP-seq
MIRT2639766	hsa-miR-329	CLIP-seq
MIRT2639767	hsa-miR-362-3p	CLIP-seq
MIRT2639768	hsa-miR-3646	CLIP-seq
MIRT2639769	hsa-miR-3688-5p	CLIP-seq
MIRT2639774	hsa-miR-380	CLIP-seq
MIRT2639775	hsa-miR-3941	CLIP-seq
MIRT2639779	hsa-miR-4477a	CLIP-seq
MIRT2639780	hsa-miR-4495	CLIP-seq
MIRT2639781	hsa-miR-4519	CLIP-seq
MIRT2639783	hsa-miR-4708-5p	CLIP-seq
MIRT2639784	hsa-miR-4731-3p	CLIP-seq
MIRT2639786	hsa-miR-4770	CLIP-seq
MIRT2639787	hsa-miR-4771	CLIP-seq
MIRT2639788	hsa-miR-4786-5p	CLIP-seq
MIRT2639789	hsa-miR-4789-3p	CLIP-seq
MIRT2124680	hsa-miR-4789-5p	CLIP-seq
MIRT2639790	hsa-miR-4801	CLIP-seq
MIRT2639791	hsa-miR-519a	CLIP-seq
MIRT2639792	hsa-miR-519b-3p	CLIP-seq
MIRT2639793	hsa-miR-519c-3p	CLIP-seq
MIRT2639794	hsa-miR-519d	CLIP-seq
MIRT2639795	hsa-miR-545	CLIP-seq
MIRT2639796	hsa-miR-548ad	CLIP-seq
MIRT2639797	hsa-miR-548p	CLIP-seq
MIRT1415677	hsa-miR-579	CLIP-seq
MIRT2639799	hsa-miR-603	CLIP-seq
MIRT2639800	hsa-miR-642b	CLIP-seq
MIRT2639801	hsa-miR-664	CLIP-seq
MIRT2639802	hsa-miR-769-5p	CLIP-seq
MIRT2639804	hsa-miR-93	CLIP-seq
MIRT2639805	hsa-miR-96	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	18806825
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	19966855
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18806825

MIM	HGNC	e!Ensembl
300771	28336	ENSG00000182916

Q9BRU2

Protein name

Transcription elongation factor A protein-like 7 (TCEA-like protein 7) (Transcription elongation factor S-II protein-like 7)

Protein function

Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcript

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04538	BEX	1 → 100	Brain expressed X-linked like family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in normal and fetal brain tissues, and weakly expressed in uterus and ovary. Down-regulated in epithelial ovarian, cervical, prostate, breast, brain and lung cancer cell lines and in brain and ovarian tumors. {ECO:0000

Sequence

MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE
EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Sequence length

100

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19966855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18806825, 19419758	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15870691, 18806825, 19419758, 31321645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24021963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24021963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18806825, 19419758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31402274	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31402274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15870691, 19419758, 31321645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19208208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31321645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15870691, 18806825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15870691, 18806825, 19966855, 23372750, 24021963, 26081045, 31321645, 31402274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31321645		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15870691, 19419758, 31321645		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15870691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19419758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19208208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	23372750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TCEAL7 (transcription elongation factor A like 7)