SPHK2 (sphingosine kinase 2)

Gene

• Entrez ID: 56848
• Gene name: Sphingosine kinase 2
• Gene symbol: SPHK2
• Synonyms (NCBI Gene): SK 2, SK-2, SPK 2, SPK-2
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes one of two sphingosine kinase isozymes that catalyze the phosphorylation of sphingosine into sphingosine 1-phosphate. Sphingosine 1-phosphate mediates many cellular processes including migration, proliferation and apoptosis, and also pla

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045673	hsa-miR-149-5p	CLASH	23622248
MIRT755431	hsa-miR-137	Luciferase reporter assay, Western blotting, qRT-PCR	37533491
MIRT755431	hsa-miR-137	Luciferase reporter assay, Western blotting, qRT-PCR	37533491
MIRT1383900	hsa-miR-1193	CLIP-seq
MIRT1383901	hsa-miR-1343	CLIP-seq
MIRT1383902	hsa-miR-1587	CLIP-seq
MIRT1383903	hsa-miR-1913	CLIP-seq
MIRT1383904	hsa-miR-3180	CLIP-seq
MIRT1383905	hsa-miR-3180-3p	CLIP-seq
MIRT1383906	hsa-miR-3187-3p	CLIP-seq
MIRT1383907	hsa-miR-3196	CLIP-seq
MIRT1383908	hsa-miR-324-3p	CLIP-seq
MIRT1383909	hsa-miR-3612	CLIP-seq
MIRT1383910	hsa-miR-3675-5p	CLIP-seq
MIRT1383911	hsa-miR-3681	CLIP-seq
MIRT1383912	hsa-miR-3691-5p	CLIP-seq
MIRT1383913	hsa-miR-378g	CLIP-seq
MIRT1383914	hsa-miR-4421	CLIP-seq
MIRT1383915	hsa-miR-4435	CLIP-seq
MIRT1383916	hsa-miR-4443	CLIP-seq
MIRT1383917	hsa-miR-4492	CLIP-seq
MIRT1383918	hsa-miR-4498	CLIP-seq
MIRT1383919	hsa-miR-4649-5p	CLIP-seq
MIRT1383920	hsa-miR-4656	CLIP-seq
MIRT1383921	hsa-miR-4667-3p	CLIP-seq
MIRT1383922	hsa-miR-4675	CLIP-seq
MIRT1383923	hsa-miR-4694-3p	CLIP-seq
MIRT1383924	hsa-miR-4701-5p	CLIP-seq
MIRT1383925	hsa-miR-4734	CLIP-seq
MIRT1383926	hsa-miR-4741	CLIP-seq
MIRT1383927	hsa-miR-4749-3p	CLIP-seq
MIRT1383928	hsa-miR-4767	CLIP-seq
MIRT1383929	hsa-miR-4802-5p	CLIP-seq
MIRT1383930	hsa-miR-485-5p	CLIP-seq
MIRT1383931	hsa-miR-509-3p	CLIP-seq
MIRT1383932	hsa-miR-522	CLIP-seq
MIRT1383933	hsa-miR-548s	CLIP-seq
MIRT1383934	hsa-miR-588	CLIP-seq
MIRT1383935	hsa-miR-604	CLIP-seq
MIRT1383936	hsa-miR-616	CLIP-seq
MIRT1383937	hsa-miR-650	CLIP-seq
MIRT1383938	hsa-miR-762	CLIP-seq
MIRT2114898	hsa-miR-1	CLIP-seq
MIRT2114899	hsa-miR-206	CLIP-seq
MIRT2114900	hsa-miR-3673	CLIP-seq
MIRT2114901	hsa-miR-3680	CLIP-seq
MIRT2114902	hsa-miR-4420	CLIP-seq
MIRT2114903	hsa-miR-613	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000786	Component	Nucleosome	IDA	19729656
GO:0001568	Process	Blood vessel development	IEA
GO:0001727	Function	Lipid kinase activity	TAS
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	ISS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0005515	Function	Protein binding	IPI	11777919, 18263879, 19729656, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16103110, 17635916, 29615132
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16103110, 17635916, 29615132
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005829	Component	Cytosol	IDA	10751414
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006669	Process	Sphinganine-1-phosphate biosynthetic process	IBA
GO:0006669	Process	Sphinganine-1-phosphate biosynthetic process	IDA	10751414, 19729656
GO:0006669	Process	Sphinganine-1-phosphate biosynthetic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	ISS
GO:0007420	Process	Brain development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008481	Function	Sphingosine kinase activity	IBA
GO:0008481	Function	Sphingosine kinase activity	IDA	10751414, 19729656
GO:0008481	Function	Sphingosine kinase activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	10751414
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS
GO:0031267	Function	Small GTPase binding	NAS	12391145
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0033008	Process	Positive regulation of mast cell activation involved in immune response	IEA
GO:0033008	Process	Positive regulation of mast cell activation involved in immune response	ISS
GO:0034248	Process	Regulation of amide metabolic process	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IMP	23106337
GO:0042393	Function	Histone binding	IDA	19729656
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16118219
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	ISS
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IDA	19729656
GO:0046512	Process	Sphingosine biosynthetic process	IBA
GO:0046512	Process	Sphingosine biosynthetic process	IEA
GO:0046512	Process	Sphingosine biosynthetic process	IGI	23106337
GO:0046512	Process	Sphingosine biosynthetic process	IMP	23106337
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	ISS
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IDA	17635916
GO:1904959	Process	Regulation of cytochrome-c oxidase activity	IMP	20959514
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	IDA	16118219
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	IEA
GO:2001169	Process	Regulation of ATP biosynthetic process	IEA
GO:2001169	Process	Regulation of ATP biosynthetic process	ISS

Other IDs

• MIM: 607092
• HGNC: 18859
• e!Ensembl: ENSG00000063176

Protein

• UniProt ID: Q9NRA0
• Protein name: Sphingosine kinase 2 (SK 2) (SPK 2) (EC 2.7.1.91)
• Protein function: Catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-dihydrosphingosine, D-erythro-sphingosine and L-threo-dihydrosphingosine. B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00781	DAGK_cat	182 → 321	Diacylglycerol kinase catalytic domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in adult kidney, liver, and brain (PubMed:10751414). Expressed in cerebral cortex and hippocampus (at protein level) (PubMed:29615132). Isoform 1 is the predominant form expressed in most tissues (PubMed:16103110). {EC
• Sequence:

  MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
  RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
  PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
  PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
  IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
  LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
  GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
  SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
  ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
  MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
  GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

• Sequence length: 654

Pathways

KEGG:

Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Efferocytosis
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis

Reactome:

Sphingolipid de novo biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24686171		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31157539		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31003959		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24686171		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	24859201		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29615132	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29576321	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31797978		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23881266, 30753812		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16106218		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31797978		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29218394		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30840833		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28467788		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20110355, 20335228, 21307639, 24486401		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15951439, 17311928, 20335228, 24422628, 24486401, 30423315	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27588496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26733171		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29321083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	30399362	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26082434		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32796926	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30648282		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22314269, 29057430		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24686171		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30949409		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31809267		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31809267	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28807595		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28465486		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26733171, 30021386		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26733171, 34639107	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30723184		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29678573		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30834454		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30452878		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30452878		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30545309		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29057430		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31063660		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16106218, 19074142, 30056170, 30250299		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24903384, 37258577	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16106218, 19074142, 30056170, 30250299		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20335228, 29697136		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22288844	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24686171		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	22314269		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28175299		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28082452		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19240180	Stimulate	★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	23043544		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28682313		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29345349		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	33500141	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30077738, 31003959, 31544710		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	31003959		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30723184		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30840833		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30840833		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30840833		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30840833		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24140934		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	20220090		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20110355, 20335228, 21307639, 24486401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29321083		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26082434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27517489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26494858		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21307639, 24686171, 26494858, 28270071, 28939554, 29057430, 30077738, 30456838, 30463717		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28465486		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	24859201		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	23043544		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36975444	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35268676	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25122609, 28467788, 29761903		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36975444	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31110049		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21896638, 24903384, 27223438, 28135860, 29748384, 30077738, 30250299		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31477835		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29057430		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23918304, 26054751, 26628299, 28428733, 29277894		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30593892		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	28682313		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29285269		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32796926	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27517489		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27517489	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27223438, 28975989, 30478856		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25310737	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	24686171		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26494858		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30834454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26485657	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23315259		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27799486, 30251698		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29392309		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19490468		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29428730		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29057430		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	19490468		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	29968759	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28975989	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26224479	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29392309		★☆☆☆☆ Found in Text Mining only